DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and Gucy2e

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:XP_036012232.1 Gene:Gucy2e / 14919 MGIID:105123 Length:1139 Species:Mus musculus


Alignment Length:286 Identity:80/286 - (27%)
Similarity:122/286 - (42%) Gaps:67/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   829 ILNNILPSHIVDVYLNSLAKHELYFENYRMVSVMFAMLINF------EMDLRSLRVLNEIIAEFD 887
            :|..:||..:.:......:....|||.   |::.|:.::.|      ...:..:.:||::...||
Mouse   886 LLTQMLPPSVAEALKMGTSVEPEYFEE---VTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFD 947

  Fly   888 TLLLFYKEYYTVEKIKIVGCTYMAACGLDLNFAGSTSTNRKESIPPTEFNEEQSRRILFQQSNED 952
            .::..:..|    |::.:|..||.|.||.                     :...:|...:.:|..
Mouse   948 AIIGAHDVY----KVETIGDAYMVASGLP---------------------QRNGQRHAAEIANMS 987

  Fly   953 LDEVVFVMTSYALDMMRTLAKSNEAYQSIAGDRNITDGTIAIGISSGEVMAGIVGASQPHYDIWG 1017
            ||    ::::.....||.:.:              ....|.||:.||..:||:||.:.|.|.::|
Mouse   988 LD----ILSAVGSFRMRHMPE--------------VPVRIRIGLHSGPCVAGVVGLTMPRYCLFG 1034

  Fly  1018 NPVNMASRMESTGLPGHIHVTEETSEIL----QQFGITCSYRGMTFVKGRGKIPTY-LVGIDENL 1077
            :.||.||||||||||..|||...|..||    |.|.:.|  ||.|.:||:|...|| |||   .|
Mouse  1035 DTVNTASRMESTGLPYRIHVNMSTVRILRALDQGFQMEC--RGRTELKGKGIEDTYWLVG---RL 1094

  Fly  1078 NF---IPQKATRFPSHQERSTVISLQ 1100
            .|   ||:.....|......  ||||
Mouse  1095 GFNKPIPKPPDLQPGASNHG--ISLQ 1118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454
Nucleotidyl_cyc_III 290..459 CDD:325147
Nucleotidyl_cyc_III 851..1071 CDD:325147 65/230 (28%)
Gucy2eXP_036012232.1 PBP1_sensory_GC_DEF-like 58..465 CDD:380594
PK_GC-2D 570..845 CDD:270945
HNOBA <854..899 CDD:400168 3/12 (25%)
CYCc 879..1070 CDD:214485 58/229 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.