DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXE and gucy1b1

DIOPT Version :9

Sequence 1:NP_652601.3 Gene:ACXE / 53426 FlyBaseID:FBgn0040506 Length:1123 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:275 Identity:72/275 - (26%)
Similarity:132/275 - (48%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 DIVHYLC----LNLVGIFYR--VMNDTVVRSSFLD--------RHQY-IKEKIWLRNARLQ---- 248
            |.:.:||    :||..:..|  .::|..:..:..|        |.:| :.:::.:...|||    
 Frog   317 DNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLR 381

  Fly   249 ----EKQ----LLDSILPPQISLPLQKDIQGRIVMAKQGIHSWTAMERTMAIQIHPDVSILYADV 305
                ||:    ||.|:|||.::..|:   ..|.|.||:                :.:|:||::.:
 Frog   382 ALEDEKKKTDTLLYSVLPPSVANEL
R---HKRPVPAKR----------------YDNVTILFSGI 427

  Fly   306 VNY-THLTTTLTVE---MLVKVLHDLYGRFDLAA------YRYKVQRIKFLGDCYYCVAGLSDPD 360
            |.: |..:...:.|   .:|.:|:|:|.|||:..      |.|||:.:   ||.|..|:|:.:|.
 Frog   428 VGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETV---GDKYMTVSGIPEPC 489

  Fly   361 PDHANNCVILGLSMINHIMEVRDIHGLDINMRIGVHSGNLFAGVIGEAKLQFDIWGLDVTIANVL 425
            ..||.:...|.|.|:....:|: :.|..:.:.||:|:|.:..||||:...::.::|..|.:.:..
 Frog   490 VHHARSICHLALDMMEIAGQVQ-VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRT 553

  Fly   426 ESTGVPGCVHISGAT 440
            |:||..|.:::|..|
 Frog   554 ETTGEKGKINVSEYT 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXENP_652601.3 AC_N <31..272 CDD:318454 22/95 (23%)
Nucleotidyl_cyc_III 290..459 CDD:325147 46/161 (29%)
Nucleotidyl_cyc_III 851..1071 CDD:325147
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 21/88 (24%)
Guanylate_cyc 412..605 CDD:306677 49/177 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.