DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alk and CERK1

DIOPT Version :9

Sequence 1:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster
Sequence 2:NP_566689.2 Gene:CERK1 / 821717 AraportID:AT3G21630 Length:617 Species:Arabidopsis thaliana


Alignment Length:321 Identity:89/321 - (27%)
Similarity:151/321 - (47%) Gaps:51/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1099 KSSFQYLVSILMISLAVLFICIAAL--IFMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDS 1161
            |||.|..|...:|:..|:.:.:|.|  :|::|..| ||.:||...   ....:.|:...::...:
plant   223 KSSKQDGVGAGVIAGIVIGVIVALLLILFIVYYAY-RKNKSKGDS---FSSSIPLSTKADHASST 283

  Fly  1162 NLNNFNPNYGCDGILNGHIDVN-------SLPQVAR--DSLQLVNALGKGAFGEVYMALYRHRDG 1217
            :|.  :...|..|:..|...::       ||.::|:  |:..|...:|:|.||.||.|..|   |
plant   284 SLQ--SGGLGGAGVSPGIAAISVDKSVEFSLEELAKATDNFNLSFKIGQGGFGAVYYAELR---G 343

  Fly  1218 DAVEMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQ 1282
            :.    .|:|.:    ..|..:.||.|..::.:.:|.|:|.|||.|.:.. .::|.|.:..|:|.
plant   344 EK----AAIKKM----DMEASKQFLAELKVLTRVHHVNLVRLIGYCVEGS-LFLVYEYVENGNLG 399

  Fly  1283 KFLRENRNTPERPSLLTMKDLLFCALDVAKGCRYMESKR---FIHRDIAARNCLLSSKGPGRVVK 1344
            :.|..:...|     |.....:..|||.|:|..|:....   ::||||.:.|.|:..|..   .|
plant   400 QHLHGSGREP-----LPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQKFR---AK 456

  Fly  1345 IADFGMSRDIYRSDYYRKGGK----AMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFS 1401
            :||||:::      ....||.    ||....:|.||. :.|..::|.||::||::|:|:.|
plant   457 VADFGLTK------LTEVGGSATRGAMGTFGYMAPET-VYGEVSAKVDVYAFGVVLYELIS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 66/225 (29%)
TyrKc 1193..1460 CDD:197581 64/216 (30%)
CERK1NP_566689.2 mltD <104..202 CDD:182727
PKc_like 328..587 CDD:419665 63/210 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.