DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alk and ROS1

DIOPT Version :9

Sequence 1:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster
Sequence 2:XP_011534351.1 Gene:ROS1 / 6098 HGNCID:10261 Length:2357 Species:Homo sapiens


Alignment Length:612 Identity:201/612 - (32%)
Similarity:290/612 - (47%) Gaps:128/612 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1011 VYLTESNGEGGSSYISPSRSLREISEIHAGASSGPGAIIIIPAI---------------EGCGCD 1060
            ||.|..|          |.||.|..:..||..:.||    ||.:               .||...
Human  1742 VYKTGEN----------STSLPESFKTKAGVPNKPG----IPKLLEGSKNSIQWEKAEDNGCRIT 1792

  Fly  1061 YRCVALDEFRSKVRCICPDGWSLKRDN-----------HTACEIREEAGKSSFQYLV-------- 1106
            |..:.:.:..|.         :|:..|           .:.|..:.:..|..||:.|        
Human  1793 YYILEIRKSTSN---------NLQNQNLRWKMTFNGSCSSVCTWKSKNLKGIFQFRVVAANNLGF 1848

  Fly  1107 -----------------------SILMISLAVLFICIAALIFMLYNRYQRKKQSKKRHKMLVEQD 1148
                                   .||.|.:.:..:....|.|:.:.|.:.:|.:|:...:|:.:|
Human  1849 GEYSGISENIILVGDDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINED 1913

  Fly  1149 LQLTRLRNNIDDSNLNNFNPNYGCDGI--LNGHIDVNSLPQVARDSLQLVNALGKGAFGEVYMAL 1211
            .:|..||.......|.|     .|..|  |....::.:||...|:.|.|...||.|||||||   
Human  1914 KELAELRGLAAGVGLAN-----ACYAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVY--- 1970

  Fly  1212 YRHRDGDAV--------EMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFDRQP 1268
                :|.||        |:.||||||::....:::.:|||||.:|:||||||::..:|||...:|
Human  1971 ----EGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEP 2031

  Fly  1269 YYIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCL 1333
            .||:|||:.||||..:||:.|.......|||:.||:...:|::|||.|:|...|||||:||||||
Human  2032 QYIILELMEGGDLLTYLRKARMATFYGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCL 2096

  Fly  1334 LSSK---GPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGIL 1395
            :|.|   .| |:|||.|||::||||::|||||.|:.:||::||.||:.:|||||:::||||||||
Human  2097 VSVKDYTSP-RIVKIGDFGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGIL 2160

  Fly  1396 LWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHL 1460
            :||:.:||..|||...|..|:..|..||||..|..||..::.:|..||...|:.||||..:.:.|
Human  2161 IWEILTLGHQPYPAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQL 2225

  Fly  1461 TACTQDASIMNAPLPNILGPTASERDDTVIRP----PNGEEFCLAVPDYLVPLP------PGGSN 1515
            ..      ..|..|.:|........:..||..    .:|:..||...| ::|:.      ..|.|
Human  2226 QL------FRNFFLNSIYKSRDEANNSGVINESFEGEDGDVICLNSDD-IMPVALMETKNREGLN 2283

  Fly  1516 NPSMASGSGYVPE-----LQRQQMSSC 1537
            ...:|:..|...|     |..|:..||
Human  2284 YMVLATECGQGEEKSEGPLGSQESESC 2310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 138/286 (48%)
TyrKc 1193..1460 CDD:197581 135/277 (49%)
ROS1XP_011534351.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.