DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alk and MST1R

DIOPT Version :9

Sequence 1:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster
Sequence 2:XP_005265227.2 Gene:MST1R / 4486 HGNCID:7381 Length:1401 Species:Homo sapiens


Alignment Length:616 Identity:166/616 - (26%)
Similarity:262/616 - (42%) Gaps:164/616 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1005 GYAGGDVYLTESNGEGGSSYISPSRSLREISEIHAGASSGPGAIIIIP------AIE----GCGC 1059
            |:..|::   .:.|:|.:.:..|  ..|.:...|      |.:..::|      ||:    |.|.
Human   837 GWVAGNL---SARGDGAAGFTLP--GFRFLPPPH------PPSANLVPLKPEEHAIKFEYIGLGA 890

  Fly  1060 DYRCVALD----------EFRSKVRCICP---------DGWSLKRDNHTACEI-----REEAGKS 1100
            ...||.::          |||..: .:||         ||..|:......|.|     |......
Human   891 VADCVGINVTVGGESCQHEFRGDM-VVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGV 954

  Fly  1101 SFQYLVSILMISLAVLFICIAALIFMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNIDDSNLNN 1165
            ....|:.||:..|.::.....||:|..:          .|.|.||        |..|::|  |.:
Human   955 PQSTLLGILLPLLLLVAALATALVFSYW----------WRRKQLV--------LPPNLND--LAS 999

  Fly  1166 FNPNYGC---------------------DGI----------LNGHIDVNSLPQVARDSLQLVN-- 1197
            .:...|.                     ||:          .:...|.:.:|.:.::|:||.:  
Human  1000 LDQTAGATPLPILYSGSDYRSGLALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLD 1064

  Fly  1198 -----------------------ALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEE 1239
                                   .:|||.||.||...|..:..:.::  .|:|:|....:.::.|
Human  1065 SALLAEVKDVLIPHERVVTHSDRVIGKGHFGVVYHGEYIDQAQNRIQ--CAIKSLSRITEMQQVE 1127

  Fly  1240 DFLKEAAIMAKFNHPNMVHLIGVCFDRQPY-YIVLELLAGGDLQKFLRENRNTPERPSLLTMKDL 1303
            .||:|..:|...||||::.|||:....:.. :::|..:..|||.:|:|..:..|      |:|||
Human  1128 AFLREGLLMRGLNHPNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNP------TVKDL 1186

  Fly  1304 LFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYRSDYY--RKGGKA 1366
            :...|.||:|..|:..::|:|||:|||||:|..   ...||:||||::|||...:||  ::...|
Human  1187 ISFGLQVARGMEYLAEQKFVHRDLAARNCMLDE---SFTVKVADFGLARDILDREYYSVQQHRHA 1248

  Fly  1367 MLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTEC 1431
            .||:|||..|:.....||:|:||||||:||||:.:.|..||.......:...:.:|.||..|..|
Human  1249 RLPVKWMALESLQTYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYC 1313

  Fly  1432 PVSIYKVMADCWNPTPEDRPTFITLL----EHLTACTQD------ASIMNAPLPNILGPTASERD 1486
            |.|:|:||..||...|..||||..|:    :.::|...|      |:.||      |||:.|.  
Human  1314 PDSLYQVMQQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMN------LGPSTSH-- 1370

  Fly  1487 DTVIRPPNGEEFCLAVPDYLVPLPPGGSNNP 1517
            :..:||..        |.: .|: ||....|
Human  1371 EMNVRPEQ--------PQF-SPM-PGNVRRP 1391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 105/307 (34%)
TyrKc 1193..1460 CDD:197581 103/298 (35%)
MST1RXP_005265227.2 Sema_RON 27..523 CDD:200540
PSI 526..>565 CDD:279745
IPT_plexin_repeat1 569..683 CDD:238585
IPT_plexin_repeat2 684..768 CDD:238584
IPT 769..860 CDD:214657 5/27 (19%)
TyrKc 1086..1339 CDD:197581 100/263 (38%)
PTKc_Met_Ron 1087..1348 CDD:270649 101/271 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1095
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.