DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alk and Tie

DIOPT Version :9

Sequence 1:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:472 Identity:124/472 - (26%)
Similarity:198/472 - (41%) Gaps:140/472 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1105 LVSILMISLAVLFICIAALIFMLYNRY---QRKKQSKKRHKMLVEQD-----------LQLTRLR 1155
            ||:::::::.|  |.:||:|..|...:   :|.|||:.....:.:|.           .|:....
  Fly   727 LVTLVLVAVGV--IPLAAIILYLVRNFVIRRRAKQSEVFDVCITDQQPISPVKKVDSKYQVDDDE 789

  Fly  1156 NNID---------------------------------DSNLNNFNPNYGCDGILNGHIDVNSLPQ 1187
            :.:|                                 |:|.|.:..|.....:.:...|..    
  Fly   790 DEVDHQHHQHMQHHQNHQNHQNHQHHQAMPMSQASQRDANHNRYGNNDDKTSLASEFHDFE---- 850

  Fly  1188 VARDSLQLVNALGKGAFGEVYMA----LYRHRDGDAVEMGVAVKTLREDPKREKEEDFLKEAAIM 1248
              |.:::|.:.||:|.||:|:.|    |..|.....:   |||||:|....:...:|   ||.||
  Fly   851 --RSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATRI---VAVKTIRACSAQVSLKD---EANIM 907

  Fly  1249 AKF-NHPNMVHLIGVCFDRQPYYIVLELLAGGDLQKFLRENR--------NTPERPSL--LTMKD 1302
            .|. :|.|:|.|:|.|.:.:|:.:::|....|.|...||..|        :.|...||  |:.:.
  Fly   908 RKLGSHQNVVTLLGACVESEPHMLIMEYAMRGRLLSLLRAARSATNILPASVPGGRSLAPLSPRT 972

  Fly  1303 LLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDI------------- 1354
            |...|||:|.|..|:..:|.:|||:||||.||...|   :.||.|||||.|:             
  Fly   973 LAGFALDIACGMEYIAGRRIVHRDLAARNVLLDHNG---MCKICDFGMSIDLDAERMRKEQEKNA 1034

  Fly  1355 -----------YRSDYYRK-------------------------------------GGKAMLPIK 1371
                       ::.|:..:                                     |.:..|||:
  Fly  1035 ANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQGQGHCSKDQPHGEKKSHHGHDTIGKRHALPIR 1099

  Fly  1372 WMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIY 1436
            ||.||:....:||::||:|:|||:|||:.:||.:||......:|:..|.:|.|...|.|.....|
  Fly  1100 WMAPESLQYHMFTTETDIWAFGIVLWEIATLGSTPYSQLTGREVIRRVPQGLRPDLPKESRHEFY 1164

  Fly  1437 KVMADCWNPTPEDRPTF 1453
            .:|:.||:..|..||:|
  Fly  1165 NLMSRCWHKEPHMRPSF 1181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 104/344 (30%)
TyrKc 1193..1460 CDD:197581 103/337 (31%)
TieNP_523928.1 TyrKc 854..1183 CDD:197581 103/337 (31%)
PTKc 860..1187 CDD:270623 102/331 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.