DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alk and Nrk

DIOPT Version :9

Sequence 1:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster
Sequence 2:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster


Alignment Length:449 Identity:140/449 - (31%)
Similarity:214/449 - (47%) Gaps:61/449 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  1063 CVALDEFRSKVRC---ICPDGWSLKRDNHTACEIREEAGKSSFQYLVSILMISLAVLFICIAAL- 1123
            |..:||......|   :|||     ..:..|.::........| :..|::.:...:.|:.|..| 
  Fly   280 CYTVDESVRWQHCDIPMCPD-----YVDPNAVDLNTPIKMEKF-FTPSMIFLLAGIGFVAIVTLH 338

  Fly  1124 --IFMLYNRYQRKKQSKKRHKMLVEQDLQLTRLRNNID-DSNLNNFNPNYGCDGILNG------- 1178
              |.::|...:.|..|:.......|..:.   :|...| ..|||......|.:|..|.       
  Fly   339 LMILLVYKLSKHKDYSQPAGAATAECSVS---MRGGGDCGGNLNTSRETLGGNGNTNTLAKWGTI 400

  Fly  1179 ------HIDVNSLPQVA--------------------RDSLQLVNALGKGAFGEVYMALYRHRDG 1217
                  |.:..:|..|.                    |..:..|.:||:||||.|:.|.......
  Fly   401 RSTATIHSNCVALTTVTNVSDAKGTKPNARLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVP 465

  Fly  1218 DAVEMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAGGDLQ 1282
            |..::.||||.|::|...:.:.||.:||.::|:|:|||:|.|:|||...:|..::.|.:|.|||.
  Fly   466 DQEDLLVAVKMLKDDASDQMQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLS 530

  Fly  1283 KFLR-----ENRNTPERPSL-LTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGR 1341
            :|||     .....|.:..| |....||..|.::|.|..|:..::|:|||:|.||||::..   .
  Fly   531 EFLRACSPYATHQAPTQDRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEH---M 592

  Fly  1342 VVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSP 1406
            .|||||||:|..||..|||:......:||:|||.|:.|...|:.::|||::||.||||||....|
  Fly   593 AVKIADFGLSHKIYLQDYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQP 657

  Fly  1407 YPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITL---LEHLTA 1462
            |.|..:.:|::.:..|..||.|...|:|:|.:|..|||..|.:||.|..:   ::|..|
  Fly   658 YFGLTHEEVIKYIKEGNVLGCPDNTPLSVYALMRRCWNRKPSERPGFAEINHCIQHSIA 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 111/304 (37%)
TyrKc 1193..1460 CDD:197581 108/275 (39%)
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527 5/18 (28%)
PTKc_Musk 435..713 CDD:133181 109/280 (39%)
Pkinase_Tyr 441..707 CDD:285015 108/268 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455363
Domainoid 1 1.000 165 1.000 Domainoid score I1208
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.