DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alk and Drl-2

DIOPT Version :9

Sequence 1:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:299 Identity:80/299 - (26%)
Similarity:137/299 - (45%) Gaps:43/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1178 GHIDVNSLPQVARDSLQLVNALGKGAFGEVYMALYRHRDGDAVEMGVAVKTLREDPKREKEEDFL 1242
            |:..:..:..|...:|.....:.:|.||.:|..    :.|::.|  ..|||:.:.....:....|
  Fly   366 GNQRLRRITSVQPGALSYEELVKEGTFGRIYAG----KLGESCE--ALVKTVIDGASLTQVACLL 424

  Fly  1243 KEAAIMAKFNHPNMVHLIGVCFDRQPYYIVLELLAG----------------GDLQKFLRENRNT 1291
            ::|::           ||||...    :|:..|||.                |:|:.:|:::|  
  Fly   425 QDASL-----------LIGVSHQ----HILAPLLANTELPGPPEIAYPHPSKGNLKMYLQKSR-- 472

  Fly  1292 PERPSLLTMKDLLFCALDVAKGCRYMESKRFIHRDIAARNCLLSSKGPGRVVKIADFGMSRDIYR 1356
             |..:.|:.:.|:...|.:.||..|:.|...:|:|||.|||.|..:.   .|||.|..:|||::.
  Fly   473 -ESSTALSTRQLVEFGLHITKGLAYLHSLGIVHKDIATRNCYLDEES---YVKICDSALSRDLFP 533

  Fly  1357 SDYYRKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVR 1421
            .||...|.....|:||:..|:....::.::.|||:.|:..||:.:|.:.|:......::...:..
  Fly   534 DDYDCLGDNENRPLKWLSLESLQKRVYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAA 598

  Fly  1422 GGRLGSPTECPVSIYKVMADCWNPTPEDRPTFITLLEHL 1460
            |.||..|..||...:.||..||:...:.|||...||.:|
  Fly   599 GFRLEQPVNCPDEFFTVMNCCWHCEAKQRPTPSQLLSYL 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 79/291 (27%)
TyrKc 1193..1460 CDD:197581 77/282 (27%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 79/292 (27%)
STYKc 389..637 CDD:214568 76/274 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.