DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alk and Ros1

DIOPT Version :9

Sequence 1:NP_001261027.1 Gene:Alk / 53425 FlyBaseID:FBgn0040505 Length:1701 Species:Drosophila melanogaster
Sequence 2:XP_038954373.1 Gene:Ros1 / 25346 RGDID:3591 Length:2339 Species:Rattus norvegicus


Alignment Length:545 Identity:186/545 - (34%)
Similarity:261/545 - (47%) Gaps:128/545 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1011 VYLTESNGEGGSSYISPSRSLREISEIHAGASSGPGAIIIIPAIEGCGCDYRCVALDEFRSKVRC 1075
            ||.|..|          |.|:.|..:..||..|.||    ||.:           |:..::.:: 
  Rat  1725 VYTTGEN----------SSSIPESFKTKAGVPSKPG----IPKL-----------LEGSKNSIQ- 1763

  Fly  1076 ICPDGWSLKRDN----------------------------------HTACEIREEAGKSSFQY-- 1104
                 |....||                                  .:.|..|.:..|.:||:  
  Rat  1764 -----WEKAEDNGNRLMYYTLEVRKSISNDSRDQSLRWTAVFNGSCSSICTWRSKNLKGTFQFRA 1823

  Fly  1105 -------------------LVS----------ILMISLAVLFICIAALIFMLYNRYQRKKQSKKR 1140
                               ||.          ||.|.:.:..:....|.|:.:...:..|.:|:.
  Rat  1824 VASNAIGFGEYSEISEDITLVEDGFWITETSFILTIIVGIFLVATVPLTFVWHRSLKNHKATKEG 1888

  Fly  1141 HKMLVEQDLQLTRLRNNIDDSNLNNFNPNYGCDGI--LNGHIDVNSLPQVARDSLQLVNALGKGA 1203
            ..:|.:.|.:|..||.......|.|     .|..:  |....::.|||...|:.|.|...||.||
  Rat  1889 LSVLNDNDQELAELRGLAAGVGLAN-----ACYAVHTLPTQEEIESLPAFPREKLSLRLLLGSGA 1948

  Fly  1204 FGEVYMALYRHRDGDAV--------EMGVAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLI 1260
            |||||       :|.||        |:.||||||::....:::.:|||||.:|:||||||::..:
  Rat  1949 FGEVY-------EGTAVDILGRGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQL 2006

  Fly  1261 GVCFDRQPYYIVLELLAGGDLQKFLRENRNTPERPSLLTMKDLLFCALDVAKGCRYMESKRFIHR 1325
            |||...:|.||:|||:.||||..:||:.|.|.....|||:.||:...:|::|||.|:|...||||
  Rat  2007 GVCLLSEPQYIILELMEGGDLLSYLRKARGTTLSGPLLTLADLVELCVDISKGCVYLEQMHFIHR 2071

  Fly  1326 DIAARNCLLSSK---GPGRVVKIADFGMSRDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTSKT 1387
            |:||||||:|.|   .| |||||.|||::|:||:.|||||.|:.:||::||.||..:||||||::
  Rat  2072 DLAARNCLVSVKDYTSP-RVVKIGDFGLAREIYKHDYYRKRGEGLLPVRWMAPENLMDGIFTSQS 2135

  Fly  1388 DVWSFGILLWEVFSLGRSPYPGQHNTQVMELVVRGGRLGSPTECPVSIYKVMADCWNPTPEDRPT 1452
            ||||||||:||:.:||..|||...|..|:..|..||||..|..||..::.:|..||...|:.|||
  Rat  2136 DVWSFGILVWEILTLGHQPYPAHSNLDVLNYVQAGGRLEPPRNCPDDLWNLMFRCWAQEPDQRPT 2200

  Fly  1453 FITLLEHLTACTQDASIMNAPLPNI 1477
            |..:.:.|..      ..|..|.|:
  Rat  2201 FYNIQDQLQL------FRNVSLNNV 2219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkNP_001261027.1 MAM 288..450 CDD:279023
MAM 288..447 CDD:99706
MAM 505..691 CDD:279023
MAM 505..689 CDD:99706
PTKc_ALK_LTK 1186..1462 CDD:270632 140/286 (49%)
TyrKc 1193..1460 CDD:197581 137/277 (49%)
Ros1XP_038954373.1 FN3 111..178 CDD:214495
FN3 211..290 CDD:238020
FN3 567..663 CDD:238020
FN3 1036..1142 CDD:238020
FN3 1449..1527 CDD:214495
FN3 1551..1630 CDD:238020
FN3 1650..1741 CDD:238020 7/25 (28%)
FN3 1746..1839 CDD:238020 14/113 (12%)
PTKc_c-ros 1948..2209 CDD:270640 132/268 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D27151at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.