DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh7 and Fer3

DIOPT Version :9

Sequence 1:NP_058560.1 Gene:Atoh7 / 53404 MGIID:1355553 Length:149 Species:Mus musculus
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:118 Identity:46/118 - (38%)
Similarity:63/118 - (53%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse    35 RLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIIALTRILA- 98
            |:.|.|:|| |||.||||||..||.|||:|||.||.:..:|:||:.|||::|::||..:..:|: 
  Fly    81 RVASMAQRR-AANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSG 144

Mouse    99 ------EAERDWVGLRCEQRGRD-------HPYLPFPGARLQVD-PEPYGQRL 137
                  ::..|..|   ...|..       ||:...|.|..|.| ..||...|
  Fly   145 TPSNSHKSRSDVYG---SMNGHHQAPPPAIHPHHLHPAAAYQRDFASPYNHSL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh7NP_058560.1 HLH 54..99 CDD:197674 21/51 (41%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 28/48 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.