DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh7 and ato

DIOPT Version :10

Sequence 1:NP_058560.1 Gene:Atoh7 / 53404 MGIID:1355553 Length:149 Species:Mus musculus
Sequence 2:NP_731223.1 Gene:ato / 40975 FlyBaseID:FBgn0010433 Length:312 Species:Drosophila melanogaster


Alignment Length:93 Identity:44/93 - (47%)
Similarity:56/93 - (60%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 GARGAPPCAGAAERAVSCAGPGRLESA--------ARRRLAANARERRRMQGLNTAFDRLRRVVP 69
            |..|:...|....:..:..|.|:....        .:||||||||||||||.||.||||||:.:|
  Fly   219 GNDGSFDLADGENQDAAAGGSGKKRRGKQITPVVKRKRRLAANARERRRMQNLNQAFDRLRQYLP 283

Mouse    70 QWGQDKKLSKYETLQMALSYIIALTRIL 97
            ..|.|::|||:||||||.:||.||..:|
  Fly   284 CLGNDRQLSKHETLQMAQTYISALGDLL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh7NP_058560.1 bHLH_TS_ATOH7 35..102 CDD:381557 39/71 (55%)
atoNP_731223.1 bHLH_TS_amos_like 250..311 CDD:381558 38/60 (63%)

Return to query results.
Submit another query.