DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atoh7 and amos

DIOPT Version :9

Sequence 1:NP_058560.1 Gene:Atoh7 / 53404 MGIID:1355553 Length:149 Species:Mus musculus
Sequence 2:NP_477446.1 Gene:amos / 35110 FlyBaseID:FBgn0003270 Length:198 Species:Drosophila melanogaster


Alignment Length:84 Identity:47/84 - (55%)
Similarity:58/84 - (69%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    21 AGAAERAVSCAGPGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQM 85
            :.|:..:.|.||.|. |...:|||||||||||||..||.|||:||.|||..|.|::|||||||||
  Fly   119 SSASSSSSSSAGFGG-EVLKKRRLAANARERRRMNSLNDAFDKLRDVVPSLGHDRRLSKYETLQM 182

Mouse    86 ALSYIIALTRILAEAERDW 104
            |.:||..|..:|:   ||:
  Fly   183 AQAYIGDLVTLLS---RDY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atoh7NP_058560.1 HLH 54..99 CDD:197674 27/44 (61%)
amosNP_477446.1 HLH 137..195 CDD:238036 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003687
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2611
SonicParanoid 1 1.000 - - X5408
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.