DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdx4 and Jafrac1

DIOPT Version :9

Sequence 1:NP_001300640.1 Gene:Prdx4 / 53381 MGIID:1859815 Length:275 Species:Mus musculus
Sequence 2:NP_001285202.1 Gene:Jafrac1 / 53578 FlyBaseID:FBgn0040309 Length:194 Species:Drosophila melanogaster


Alignment Length:172 Identity:119/172 - (69%)
Similarity:145/172 - (84%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    83 KISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTE 147
            ::.||||.:.||||:||.||::||:||:|||||.||||||||||||||||||.:...||:.||.|
  Fly     3 QLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCE 67

Mouse   148 VVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKG 212
            |:.||.||||||||||||||:|||||.:.||||:|.:.::::||||..|::|...|||||||||.
  Fly    68 VIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQ 132

Mouse   213 VLRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEDNPRSSWK 254
            .|||||:|||||||||:||||||||||||||:||..| ::||
  Fly   133 NLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCP-ANWK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdx4NP_001300640.1 PRX_Typ2cys 84..254 CDD:239313 117/169 (69%)
AhpC-TSA 84..217 CDD:278975 88/132 (67%)
Jafrac1NP_001285202.1 PRX_Typ2cys 4..175 CDD:239313 119/171 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0450
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54000
OrthoDB 1 1.010 - - D1326484at2759
OrthoFinder 1 1.000 - - FOG0000434
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100111
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X272
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.