DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLD2 and CG7718

DIOPT Version :9

Sequence 1:NP_002654.3 Gene:PLD2 / 5338 HGNCID:9068 Length:933 Species:Homo sapiens
Sequence 2:NP_650751.3 Gene:CG7718 / 42254 FlyBaseID:FBgn0038649 Length:494 Species:Drosophila melanogaster


Alignment Length:540 Identity:111/540 - (20%)
Similarity:179/540 - (33%) Gaps:149/540 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   300 RWWAQEITELAQGPGRDFLQ-LHRHDS-YAPPRPGTLA----RWFVNGAGYFAAVADAIL----- 353
            |.::||::..|||   |||. |.:..| .|...||..|    .|..|.|..|....|.|.     
  Fly     7 RLFSQELSPAAQG---DFLGCLQQAPSVLATGFPGAPALESLSWLHNLAPCFPLRGDQIQVIHEP 68

Human   354 ------------RAQEEIFITDWWLS----PEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLF 402
                        :|:..|.:...:|.    ....::...||          .:.:..:|:::|| 
  Fly    69 KHFYETLVQRIGQAKRRIVLASLYLGTGQLENAMVQTLRHS----------LEQQSALRLNVLL- 122

Human   403 KEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLD--LAYGRW 465
               :...|.....:.:.::|  |.::  ....||.|..:|         ...|.|:.  ||..||
  Fly   123 ---DFTRGTRGTLNSKTMLL--PLVR--DFASQVQLSLYH---------TPDLRGMTKRLAPPRW 171

Human   466 DDL----HYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPF 526
            ::|    |.::....|:...:.:             :|| |.:|...:|...||.      |:|.
  Fly   172 NELLGLQHMKVYLFDDAVIISGA-------------NLS-NDYFTNRQDRYILIE------DKPL 216

Human   527 ED----FIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTS 587
            .|    ||:|.       ::..:.|    |.|.:....:.|........|.:   :..|..|..|
  Fly   217 ADFYAQFIERV-------QEFSLAV----APDASEGLHRNWRILPYEGTKEQ---FIQLARKRIS 267

Human   588 TANQLPFTLPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRT 652
            ...|..|.   .|..|.:.....|.|....||...:..:        |...:..:...:|..|..
  Fly   268 DLVQETFQ---RQARTKEQNPQADTWIFPLLEMGQIGIH--------HDSVVTKRLLSNCLSGSR 321

Human   653 VLNKVG-----DEIVDRILKAHKQGWCYRVYVLL---PLLPGFEGDISTGGGNSIQAILHFTYRT 709
            :....|     .|.:|.:  .||   |.....:|   |...||:|.....||      :...|..
  Fly   322 LKLATGYFNLTQEYMDTL--THK---CLAQCSILMAHPNANGFQGAKGPAGG------IPAAYTL 375

Human   710 LCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGG---HPVSELIYIHSKVLIADDRTVIIGS 771
            :.:..|..|.|.|......:.:|          |..|   |......|:...:|   ....:|||
  Fly   376 IAKSFYESLVRRKQNHRVNFFEY----------EKPGWTYHAKGLWYYLPEAIL---PNLTLIGS 427

Human   772 ANINDRSLLGKRDSELAVLI 791
            :|..:||:  .||.|..|.:
  Fly   428 SNFGERSV--NRDLETQVCL 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLD2NP_002654.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
PX_domain 62..192 CDD:295365
PLN02866 66..918 CDD:215467 111/540 (21%)
PH_PLD 180..309 CDD:269956 3/8 (38%)
PLDc_SF 335..475 CDD:301585 30/170 (18%)
Catalytic 441..788 75/367 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 477..497 1/19 (5%)
PLDc_vPLD2_2 614..795 CDD:197303 39/189 (21%)
CG7718NP_650751.3 PLDc_PGS1_euk_1 61..227 CDD:197233 37/212 (17%)
PLDc_2 75..226 CDD:289836 36/197 (18%)
PLDc_PGS1_euk_2 289..474 CDD:197235 40/191 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.