DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFYVE1 and CG41099

DIOPT Version :9

Sequence 1:NP_067083.1 Gene:ZFYVE1 / 53349 HGNCID:13180 Length:777 Species:Homo sapiens
Sequence 2:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster


Alignment Length:363 Identity:76/363 - (20%)
Similarity:122/363 - (33%) Gaps:142/363 - (39%)


- Green bases have known domain annotations that are detailed below.


Human   532 DTVVRTEIVHVWPGTDGFLKD--------------NNNAAQRLLD------------GMNFMAQS 570
            |.::...:.|  |..|..|:|              |:|||||:||            |.||:..:
  Fly   768 DEIISILLCH--PDIDLKLRDKSGNTPFATALDFRNHNAAQRILDRFPTAAEQMDIRGRNFLHLA 830

Human   571 VSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNK------CATSFKDNDTKHHCRACGEGFCD 629
            :.:..|   ::|...|..|:     ..||::...|:      .|.|..:..|::...| |....:
  Fly   831 ILKDDL---ESVLFLLAIQV-----DVNSRVHDANQSSPLHLAAASQNEMITRNLILA-GARMNE 886

Human   630 SCSSKTRPVP---ERGWGPAPVRVCDN--------------------CYEARNVQLAVTEAQVDD 671
            ..:.:..|:.   |||..||...:..|                    |.:...|:..:||::|:.
  Fly   887 RDAVQKLPLHIAIERGNLPAVSALIQNNADYDATDADGNNALHIAVRCAQFFIVRELLTESRVNA 951

Human   672 EGGTLIARKVGEAVQNTLGAVVTAI-DIPLGLVKD---AARPAY--WVPD--------------- 715
            |...|..|       |.|..:...: |...||:.:   .:.|.|  .:||               
  Fly   952 EATNLKGR-------NPLHELCRVVEDSTAGLICELFLESMPKYPINIPDMDGNTPLLLSFMRGQ 1009

Human   716 -----------------------------------HEIL-------------HCHNCRKEFSIKL 732
                                               |.:|             :|.:|...|:|.:
  Fly  1010 SPLCKILVKAGACLGTENKDGINIFNFKLATDQLLHNLLDQLPQESPWAESDYCQHCTNRFTITM 1074

Human   733 SKHHCRACGQGFCDECSHDRRAVPSRGWDHPVRVCFNC 770
            .|||||.||:..|.:||.:...:...|.:.|||||..|
  Fly  1075 RKHHCRHCGRVLCSKCSCNDVPILKFGINKPVRVCTVC 1112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFYVE1NP_067083.1 GBP 174..410 CDD:206650
Required for localization in the lipid droplets. /evidence=ECO:0000269|PubMed:30970241, ECO:0000269|PubMed:31293035 416..777 76/363 (21%)
FYVE_like_SF 594..655 CDD:333710 15/89 (17%)
FYVE_ZFYV1 711..771 CDD:277273 26/125 (21%)
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125
ANK repeat 468..501 CDD:293786
Ank_2 473..572 CDD:289560
ANK repeat 503..539 CDD:293786
ANK 536..660 CDD:238125
ANK repeat 541..572 CDD:293786
ANK repeat 574..637 CDD:293786
Ank_2 579..670 CDD:289560
ANK repeat 639..670 CDD:293786
Ank_2 644..752 CDD:289560
ANK repeat 672..721 CDD:293786
ANK 721..843 CDD:238125 19/79 (24%)
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738 48/226 (21%)
ANK repeat 754..786 CDD:293786 5/19 (26%)
ANK 820..944 CDD:238125 24/132 (18%)
ANK repeat 822..855 CDD:293786 9/40 (23%)
ANK repeat 857..888 CDD:293786 6/31 (19%)
ANK 885..1017 CDD:238125 24/138 (17%)
ANK repeat 890..921 CDD:293786 7/30 (23%)
ANK repeat 923..955 CDD:293786 6/31 (19%)
ANK repeat 996..1021 CDD:293786 0/24 (0%)
FYVE_ANFY1 1054..1116 CDD:277267 21/59 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.