DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZFYVE1 and Hrs

DIOPT Version :9

Sequence 1:NP_067083.1 Gene:ZFYVE1 / 53349 HGNCID:13180 Length:777 Species:Homo sapiens
Sequence 2:NP_525099.3 Gene:Hrs / 33458 FlyBaseID:FBgn0031450 Length:760 Species:Drosophila melanogaster


Alignment Length:291 Identity:64/291 - (21%)
Similarity:97/291 - (33%) Gaps:85/291 - (29%)


- Green bases have known domain annotations that are detailed below.


Human   375 RRALEQLLENNTTR---SPRHPGVIFKALKALSDRFSGEIPDDQMAHSSFFPDEYFTCSSLCLSC 436
            |.:.::.|||.|:.   .|..|.::...              |::......|...|         
  Fly     3 RSSFDKNLENATSHLRLEPDWPSILLIC--------------DEINQKDVTPKNAF--------- 44

Human   437 GVGCKKSMNHGKEGVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGLAK 501
             ...||.||...   ||                   .:||......|:|....|.....      
  Fly    45 -AAIKKKMNSPN---PH-------------------SSCYSLLVLESIVKNCGAPVHEE------ 80

Human   502 YAWSGYVIECPNCGVVYRSRQYWFGNQDPVDTVVR--TEIVHVWPGTDGFLKDNNNAAQRLLDGM 564
                  |....|| .::.|    |....|.:.|.:  .|:|..|    .:...:::..|.:.|.|
  Fly    81 ------VFTKENC-EMFSS----FLESTPHENVRQKMLELVQTW----AYAFRSSDKYQAIKDTM 130

Human   565 NFM---AQSVSELSLGPTKAVTSWLTDQIAPAYWRPNSQILSCNKCATSFKDNDTKHHCRACGEG 626
            ..:   ..:..||     :...:..|...|| .|....   .|::|...|...:.|||||.||:.
  Fly   131 TILKAKGHTFPEL-----READAMFTADTAP-NWADGR---VCHRCRVEFTFTNRKHHCRNCGQV 186

Human   627 FCDSCSSKTRPVPERGWGPAPVRVCDNCYEA 657
            ||..|::|..|:|:.|. ...|||||.|:.|
  Fly   187 FCGQCTAKQCPLPKYGI-EKEVRVCDGCFAA 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZFYVE1NP_067083.1 GBP 174..410 CDD:206650 7/37 (19%)
Required for localization in the lipid droplets. /evidence=ECO:0000269|PubMed:30970241, ECO:0000269|PubMed:31293035 416..777 56/247 (23%)
FYVE_like_SF 594..655 CDD:333710 23/60 (38%)
FYVE_ZFYV1 711..771 CDD:277273
HrsNP_525099.3 VHS_Hrs_Vps27p 2..143 CDD:239626 34/206 (17%)
FYVE_Hrs 157..217 CDD:277260 25/64 (39%)
Hrs_helical 377..471 CDD:289018
GBP_C <456..520 CDD:303769
coiled coil 501..512 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1818
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.