Protein Alignment ZFYVE1 and CG15602

DIOPT Version :9

• Sequence 1: NP_067083.1
• Gene: ZFYVE1 / 53349
• HGNCID: 13180
• Length: 777
• Species: Homo sapiens
• Sequence 2: NP_001285298.1
• Gene: CG15602 / 32533
• FlyBaseID: FBgn0030694
• Length: 342
• Species: Drosophila melanogaster
• Alignment Length: 71
• Identity: 22/71 - (30%)
• Similarity: 31/71 - (43%)
• Gaps: 6/71 - (8%)

Human   602 LSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTE 666
            :||..|...:.....::.|..||..||..|..:..||| |..|... .||..||:    :|:..:
  Fly     1 MSCFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVP-RHAGKVH-NVCLICYD----KLSKLQ 59

Human   667 AQVDDE 672
            |..|.|
  Fly    60 ASADAE 65

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
ZFYVE1	NP_067083.1	GBP	174..410	CDD:206650
		Required for localization in the lipid droplets. /evidence=ECO:0000269|PubMed:30970241, ECO:0000269|PubMed:31293035	416..777		22/71 (31%)
		FYVE_like_SF	594..655	CDD:333710	16/52 (31%)
		FYVE_ZFYV1	711..771	CDD:277273
CG15602	NP_001285298.1	PHD_SF	2..52	CDD:304600	16/51 (31%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1818
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900