powered by:
Protein Alignment ZFYVE1 and CG15602
DIOPT Version :9
Sequence 1: | NP_067083.1 |
Gene: | ZFYVE1 / 53349 |
HGNCID: | 13180 |
Length: | 777 |
Species: | Homo sapiens |
Sequence 2: | NP_001285298.1 |
Gene: | CG15602 / 32533 |
FlyBaseID: | FBgn0030694 |
Length: | 342 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 22/71 - (30%) |
Similarity: | 31/71 - (43%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Human 602 LSCNKCATSFKDNDTKHHCRACGEGFCDSCSSKTRPVPERGWGPAPVRVCDNCYEARNVQLAVTE 666
:||..|...:.....::.|..||..||..|..:..||| |..|... .||..||: :|:..:
Fly 1 MSCFGCGRKYGLFCKEYGCPNCGYSFCSKCLKRPMPVP-RHAGKVH-NVCLICYD----KLSKLQ 59
Human 667 AQVDDE 672
|..|.|
Fly 60 ASADAE 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1818 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.