DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATP6V0B and Vha16-3

DIOPT Version :9

Sequence 1:NP_001281262.1 Gene:ATP6V0B / 533 HGNCID:861 Length:261 Species:Homo sapiens
Sequence 2:NP_001189086.1 Gene:Vha16-3 / 317846 FlyBaseID:FBgn0028667 Length:158 Species:Drosophila melanogaster


Alignment Length:149 Identity:50/149 - (33%)
Similarity:82/149 - (55%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    47 FMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVI 111
            |.:.::|...||..|.:|||:|...:|:.|....|..|.:..|:::.::....:||||::::::|
  Fly    15 FFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGLVVSVLI 79

Human   112 SNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKI 176
            :.     |.:|...|     ..||....|||:||.:.|..|..:||||.......||.|.|||.:
  Fly    80 AG-----SLSDSYTI-----RKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGM 134

Human   177 LIVEIFGSAIGLFGVIVAI 195
            :::.||...:||:|:||||
  Fly   135 ILILIFAEVLGLYGLIVAI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATP6V0BNP_001281262.1 PRK08344 48..199 CDD:236246 49/148 (33%)
ATP-synt_C 52..112 CDD:278563 17/59 (29%)
ATP-synt_C 136..196 CDD:278563 26/60 (43%)
Vha16-3NP_001189086.1 V_ATP_synt_C 16..121 CDD:130170 34/114 (30%)
ATP-synt_Vo_c_ATP6C_rpt2 91..156 CDD:349416 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.