DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG7432

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:438 Identity:103/438 - (23%)
Similarity:160/438 - (36%) Gaps:139/438 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    98 TVLQQTYHAHRSDALQLGLGKHNYCRNPDNRR--------------------------------- 129
            |.|.|.  |..||....|....|||:.|..||                                 
  Fly   313 TPLDQL--AEASDEAGTGKDVENYCKTPSGRRGRCEDLSSCPALLLNLSSLRESLCFKSLYVPGV 375

Human   130 -----------------------------------------RPWCYVQVGLKLLVQECMVHDCAD 153
                                                     ||......||.|:.|         
  Fly   376 CCPISSSSTVLTTQKPLRLTTRPTTTTSTTKATQPTKKSTVRPTTRPTSGLVLIPQ--------- 431

Human   154 GKKPSS-----------PPEEL---------KFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYR 198
             |||.:           .||.|         ..:|||:..... :|:||........||.|||: 
  Fly   432 -KKPPTTTTTTTTEVPLEPEGLDEIGNNIVDPDECGQQEYSTG-RIVGGVEAPNGQWPWMAAIF- 493

Human   199 RHRGGSVTYVCGGSLISPCWVISATHCFIDYPKK----EDYIVYLGRSRLNSNTQ--GEMKFEVE 257
            .|......:.||||||...::::|.||..|..:|    ..:.|.||...|:::.:  ..:.|.|:
  Fly   494 LHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRLGDIDLSTDAEPSDPVTFAVK 558

Human   258 NLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQF----GTSCEITGF 318
            .:..|:.:|  .:..:||||:|.:    .:..:.|:.:..:|||.....|..    |....:.|:
  Fly   559 EVRTHERFS--RIGFYNDIAILVL----DKPVRKSKYVIPVCLPKGIRMPPKERLPGRRATVVGW 617

Human   319 ------GKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSG 377
                  |||:::.    .|.::.:.:   :.:|.:.::  ..:....:||.......|:||||||
  Fly   618 GTTYYGGKESTSQ----RQAELPIWR---NEDCDRSYF--QPINENFICAGYSDGGVDACQGDSG 673

Human   378 GPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE 425
            |||:..........|:||:|..|.....|||||||:.:|.|||.||::
  Fly   674 GPLMMRYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIRDHTRD 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056 19/127 (15%)
Connecting peptide 152..177 9/44 (20%)
Tryp_SPc 179..422 CDD:238113 73/258 (28%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829 4/42 (10%)
Tryp_SPc 474..715 CDD:214473 70/256 (27%)
Tryp_SPc 475..718 CDD:238113 73/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.