DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG31266

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:270 Identity:67/270 - (24%)
Similarity:112/270 - (41%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   175 PRFKIIGGEFTTIENQPWFAAI---YRRHRGGSVTYVCGGSLISPCWVISATHCF---------- 226
            |:.::|||......|.||.|:|   |..|       :||..::...||::|..|.          
  Fly    48 PQGRVIGGTTAAEGNWPWIASIQNAYSYH-------LCGAIILDETWVLTAASCVAGLRPLNLLV 105

Human   227 ----IDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGR 287
                :|:  .:.|..|               :.|..:.:|.::  |...:|||||||::.||   
  Fly   106 VTGTVDW--WDLYAPY---------------YTVSQIHVHCNF--DKPLYHNDIALLQLSSK--- 148

Human   288 CAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENS--TDYLYPEQLKMTVVKLISHRECQQPHY 350
             .:.:...:.|.|..: ::.:.|......|:|...:  |...|.::...|.:.:.:.||..|.. 
  Fly   149 -IEFNDVTKNITLADI-DELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACREKLQNQ- 210

Human   351 YGSEVTTKMLCAADPQWKTD----SCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTR 411
              .:|....:|.     :.|    :|.||:||||:...|   .|.||.:||..|. :..|.||.|
  Fly   211 --DDVDLGHVCV-----QMDAGQGACHGDTGGPLIDEQQ---RLVGIGNWGVPCG-RGYPDVYAR 264

Human   412 VSHFLPWIRS 421
            .:.:..|||:
  Fly   265 TAFYHDWIRT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177 1/1 (100%)
Tryp_SPc 179..422 CDD:238113 66/266 (25%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 63/263 (24%)
Tryp_SPc 52..275 CDD:238113 66/266 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.