DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG6865

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_001246825.1 Gene:CG6865 / 40050 FlyBaseID:FBgn0036817 Length:285 Species:Drosophila melanogaster


Alignment Length:265 Identity:79/265 - (29%)
Similarity:128/265 - (48%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   178 KIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID------YPKKEDYI 236
            ||:||........|:..::.|  |||   :.|||::||..|:::|.||..:      .|.:...:
  Fly    34 KIVGGSEAERNEMPYMVSLMR--RGG---HFCGGTIISERWILTAGHCICNGLQQFMKPAQIQGV 93

Human   237 VYLG--RSRLN--SNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQP---SRT 294
            |.|.  |..||  .|....::.:.:|::.|..|..:.:.|  |||||::       .||   |..
  Fly    94 VGLHSIREYLNGIGNGPDALRVDFKNIVPHPQYDCNDVKH--DIALLEL-------VQPIRFSSH 149

Human   295 IQTICLPSMYN----DPQFGTSCEITGFG--KENSTDYLYPEQLKMTVVKLISHRECQQPHY--- 350
            ||..|:.|...    :.::||   ::|:|  .||..:....:.|:...||:.::..|::.:.   
  Fly   150 IQPSCVGSEEGHRSLEQEYGT---VSGWGWTHENQAENDRSDVLRKATVKIWNNEACERSYRSLG 211

Human   351 YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHF 415
            ..:.:....|||.....:.|||..||||||   :.....|.|:||.|.|||....||:|||||.:
  Fly   212 KSNTIGETQLCAGYENGQIDSCWADSGGPL---MSKEHHLVGVVSTGIGCARPGLPGIYTRVSKY 273

Human   416 LPWIR 420
            :.|::
  Fly   274 VSWMQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177
Tryp_SPc 179..422 CDD:238113 78/264 (30%)
CG6865NP_001246825.1 Tryp_SPc 34..276 CDD:214473 78/261 (30%)
Tryp_SPc 35..280 CDD:238113 78/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.