DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG4998

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:427 Identity:124/427 - (29%)
Similarity:189/427 - (44%) Gaps:85/427 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    45 FSNIHWCNCPKKFGG-----QHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTY 104
            |::|:..:.| .|||     ||  :::|.....|:         ||.      |.||        
  Fly   794 FNSIYPGSSP-DFGGYGEYSQH--VERSANVSGGD---------TDR------PSNS-------- 832

Human   105 HAHRSDALQLG-------------LGKHNYCRNPDNRRRP-----WC-------YVQVGLKLLVQ 144
             ..|...|.||             .|........|.|||.     |.       ....|.:.:.:
  Fly   833 -GRRGKQLNLGPLYNIPTPAPGEAAGSDRITFPRDRRRRSVEDGVWAGAAPKEQRAYYGNRPVEK 896

Human   145 ECMVHD--CADGKKPSSPPEELKFQCGQKT---LRPRFK---IIGGEFTTIENQPWFAAIYRRHR 201
            .|.:::  |....:|.:||::.. :||.:.   :..|.|   .:.|: :.....||..||.::..
  Fly   897 TCRINEVCCRRPLRPQAPPQQFG-RCGVRNAAGITGRIKNPVYVDGD-SEFGEYPWHVAILKKDP 959

Human   202 GGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQ--GEMKFEVENLILHKD 264
            ..|: |.|||:||....:|||.|| |......|..|.||...:|.:.:  ..::.:|.::.:|.:
  Fly   960 KESI-YACGGTLIDAQHIISAAHC-IKSQNGFDLRVRLGEWDVNHDVEFFPYIERDVVSVHIHPE 1022

Human   265 YSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQF-GTSCEITGFGKENSTDY-L 327
            |.|.||  .||:|:||:.........|.  |...|||..|:|  | |..|..||:||:...:: .
  Fly  1023 YYAGTL--DNDLAVLKLDQPVDFTKNPH--ISPACLPDKYSD--FTGARCWTTGWGKDAFGEHGK 1081

Human   328 YPEQLKMTVVKLISHRECQQPHY-----YGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGR 387
            |...||...|.::||::|:....     |..::....:||...:.| |:|:||.||||||...|.
  Fly  1082 YQNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGK-DACKGDGGGPLVCDRNGA 1145

Human   388 MTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK 424
            |.:.|:||||.||...:.||||.:||.:||||:..|:
  Fly  1146 MHVVGVVSWGIGCGQVNVPGVYVKVSAYLPWIQQITQ 1182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57 3/11 (27%)
KR 67..152 CDD:238056 19/111 (17%)
Connecting peptide 152..177 5/27 (19%)
Tryp_SPc 179..422 CDD:238113 88/251 (35%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 87/247 (35%)
Tryp_SPc 942..1177 CDD:214473 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.