DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and mas

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:263 Identity:85/263 - (32%)
Similarity:126/263 - (47%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   174 RPRFKIIGGEFTTIENQPW---FAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDY 235
            |.|.:::|||  ..||..|   .|.|...::     |:||.:||...||::|.||..:..:..|.
  Fly   798 RRRARVVGGE--DGENGEWCWQVALINSLNQ-----YLCGAALIGTQWVLTAAHCVTNIVRSGDA 855

Human   236 I-VYLGRSRLNS--NTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRS----KEGRCAQPSR 293
            | |.:|...|..  .:.|.....|....:|.::::.||  .|||||||:..    ::|.|     
  Fly   856 IYVRVGDYDLTRKYGSPGAQTLRVATTYIHHNHNSQTL--DNDIALLKLHGQAELRDGVC----- 913

Human   294 TIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK 358
               .:|||:.......|..|.:||:|.......: |.:::...:.::|..||.:.   .:.||.|
  Fly   914 ---LVCLPARGVSHAAGKRCTVTGYGYMGEAGPI-PLRVREAEIPIVSDTECIRK---VNAVTEK 971

Human   359 M-------LCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFL 416
            :       .||...:.. |:||||.||||||...|...|.|:||||.||..:|.||||.:.|.|:
  Fly   972 IFILPASSFCAGGEEGH-DACQGDGGGPLVCQDDGFYELAGLVSWGFGCGRQDVPGVYVKTSSFI 1035

Human   417 PWI 419
            .||
  Fly  1036 GWI 1038

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177 1/2 (50%)
Tryp_SPc 179..422 CDD:238113 83/258 (32%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 83/258 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.