DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG30414

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:325 Identity:93/325 - (28%)
Similarity:133/325 - (40%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   134 YVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRF--KIIGGEFTTIENQPWFAAI 196
            ::..||.|||       |:......:|...|...||  |.:|.|  .|.||....:.:.||...:
  Fly     3 FIAAGLALLV-------CSIQLGEGAPGHLLDSSCG--TTKPEFIPMITGGADAGLFSNPWMVKV 58

Human   197 YRRHRGGSVTYVCGGSLISPCWVISATHCFID-------------YPKKE-------DYIVYLGR 241
            ....       :||||||:..:|::|.||.:.             :|.|:       .|  .|.|
  Fly    59 LGEK-------LCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSY--KLRR 114

Human   242 SRL---NSNTQGE-------MKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQ 296
            .||   ::...|:       .:..|:..|||.||:   |...|||.||:::|    ..|.|..::
  Fly   115 IRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYN---LNLDNDIGLLRMKS----FVQYSDYVR 172

Human   297 TICL---PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTK 358
            .|||   ..|...|.|    .|||:|..|  |.....:|:...|.......|:..  :..:|...
  Fly   173 PICLLVEGHMAESPIF----NITGWGVTN--DGTPSRRLQRATVYNTDLHFCRSK--FTKQVDES 229

Human   359 MLCAADPQWKTDSCQGDSGGPLVCSLQ-GRMTLT---GIVSWGRGCALKDKPGVYTRVSHFLPWI 419
            .:|||..  .:|:|.|||||||...:. ....||   |:||:  |.|......|||.|:|...||
  Fly   230 QICAAGT--NSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSY--GSAACHSFSVYTNVTHHRDWI 290

Human   420  419
              Fly   291  290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056 5/17 (29%)
Connecting peptide 152..177 6/24 (25%)
Tryp_SPc 179..422 CDD:238113 80/278 (29%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 78/276 (28%)
Tryp_SPc 41..290 CDD:238113 78/276 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.