DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG3700

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:444 Identity:109/444 - (24%)
Similarity:170/444 - (38%) Gaps:125/444 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     7 RLLLCVLVVSDSKGSNELHQVPSNCDCLNG-GTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTC 70
            ::||.:..||         .|...||  || |.|      ..:...:||..|..||....:.|.|
  Fly     8 QILLLIASVS---------VVTEYCD--NGTGEC------KELTPSDCPVIFYNQHLIGAEVKYC 55

Human    71 YEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYV 135
            .|.|          |.:   |.|                    :.|...|.  .|..:.||:   
  Fly    56 DEFN----------DIV---CCP--------------------IPLDHQNL--KPAEQTRPF--- 82

Human   136 QVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAI--YR 198
                   .::|..::            |::..|.....     |:||...:.:..|:.|.|  :|
  Fly    83 -------EKQCKQYN------------EVRSACQSTPF-----IVGGTKASGKEFPFMALIGTHR 123

Human   199 RHRGGS-VTYVCGGSLISPCWVISATHCF-------------IDYPKKEDYIVYLGRSRLNSNTQ 249
            .::..| :.:.||||::.|.:|::|.||.             .|.||   ::|.||....||.|.
  Fly   124 PNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPK---FVVRLGELDYNSTTD 185

Human   250 GEM--KFEVENLILHKDYSA--DTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL-PSMYNDPQF 309
            ..:  .|.|.|.::|..|..  :.....|||||:::..|    |:.:..:..:|| |...||.| 
  Fly   186 DALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRK----AEFNDHVAAVCLPPDSGNDVQ- 245

Human   310 GTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQG 374
                ::|..|...:.|.:....|....::..|...||:...:..:..|: .||.....:.|:|.|
  Fly   246 ----QVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQ-FCAGSMSSQADTCNG 305

Human   375 DSGGPLV-------CSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRS 421
            |||||:.       |..|    :.||||:|..|..:..|.|||:|..:..||.|
  Fly   306 DSGGPIFVQHPLYPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57 6/23 (26%)
KR 67..152 CDD:238056 13/84 (15%)
Connecting peptide 152..177 2/24 (8%)
Tryp_SPc 179..422 CDD:238113 78/271 (29%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/271 (29%)
Tryp_SPc 102..353 CDD:214473 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.