DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG4927

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_001033953.1 Gene:CG4927 / 36852 FlyBaseID:FBgn0034139 Length:362 Species:Drosophila melanogaster


Alignment Length:444 Identity:105/444 - (23%)
Similarity:167/444 - (37%) Gaps:110/444 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     1 MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNG-GTCVSNKYFSNIHWCNCPKKFGGQHCEI 64
            |:.:...||:..::.|         .:...||  || |.|      ..:...:||..|...|...
  Fly     1 MQVIFGILLILAVICS---------ILSEFCD--NGTGEC------KELSATDCPSIFFNLHLIR 48

Human    65 DKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRR 129
            :..|.|.:.| |..           .||..|:.....|.:.|:                      
  Fly    49 NFVKYCDKSN-HIV-----------CCLLPNNMQPQSQQFSAN---------------------- 79

Human   130 RPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFA 194
                   :||:...:||...:            |::..|     |....|:||........|:.|
  Fly    80 -------IGLRRFEKECRRFN------------EIRTSC-----RTTPFIVGGAKAAGREFPFMA 120

Human   195 AIYRRHRGGS-VTYVCGGSLISPCWVISATHCFIDYPKKED----------YIVYLGRSRLNSNT 248
            .:.:|.:..| :.:.||..:|.|.:|::|.||......||.          |:|.||....||.|
  Fly   121 LLGQRGKNSSQIDWDCGAIIIHPKFVLTAAHCLETSETKEQRLDPNYDGPKYVVRLGELDYNSTT 185

Human   249 QG--EMKFEVENLILHKDYSA--DTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQF 309
            ..  ...|.|.|.::|..|..  ||.:..||||::::..:    |..|..:...|||....:.|.
  Fly   186 DDAQPQDFRVLNYVVHPAYGEDDDTGSRKNDIAVVELEME----ATFSEYVAPACLPLDGGNEQL 246

Human   310 GTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQG 374
            ..:.  .|:|..:.:.:.....||:::.: ....||.|...:..:|.|: |||.......|:|.|
  Fly   247 QVAA--AGWGATSESGHASSHLLKVSLDR-YDVAECSQRLEHKIDVRTQ-LCAGSRSTSADTCYG 307

Human   375 DSGGPLV-------CSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRS 421
            |||||:.       |..|    :.||.|:|..|.::..|.|||:|..:..||.:
  Fly   308 DSGGPVFVQHPIYSCLKQ----VIGITSYGLVCGVQGLPSVYTKVHLYTDWIEN 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57 6/23 (26%)
KR 67..152 CDD:238056 13/84 (15%)
Connecting peptide 152..177 3/24 (13%)
Tryp_SPc 179..422 CDD:238113 75/265 (28%)
CG4927NP_001033953.1 Tryp_SPc 105..358 CDD:238113 75/265 (28%)
Tryp_SPc 105..355 CDD:214473 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.