DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG31827

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:279 Identity:87/279 - (31%)
Similarity:126/279 - (45%) Gaps:34/279 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   162 EELKFQCG---QKTLRPRFKIIGGEFTTIENQPW-FAAIYRRHRGGSVTYVCGGSLISPCWVISA 222
            ||||  ||   ...::.:|.:..|:....| .|| .|.|:.|      :.|.|||||:|..|::|
  Fly    27 EELK--CGYGNPDAVKVQFNVTEGQAKPAE-FPWTIAVIHNR------SLVGGGSLITPDIVLTA 82

Human   223 THCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE---VENLILHKDYSADTLAHHNDIALLKIRSK 284
            .|...: ...||.:|..|.....|..: :..||   |..:::||.::....|  |::|||.:   
  Fly    83 AHRIFN-KDVEDIVVSAGEWEYGSALE-KYPFEEAFVLKMVIHKSFNYQRGA--NNLALLFL--- 140

Human   285 EGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQ--- 346
             .|....:..|.|||||:...... .|.|.:.|:||...:|..|...||...:.::....||   
  Fly   141 -DREFPLTYKINTICLPTQKRSLS-STRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQL 203

Human   347 QPHYYGSEVTTK--MLCAADPQWKTDSCQGDSGGPLVCSL---QGRMTLTGIVSWGRGCALKDKP 406
            :....|...|..  ::||...: ..|:|.||.||.|.|.:   ..:....|||:||.||..|:.|
  Fly   204 RKTRLGQNYTLPRGLICAGGEK-DNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCKEKNVP 267

Human   407 GVYTRVSHFLPWIRSHTKE 425
            ..||.|..|.|||....||
  Fly   268 ATYTDVFEFKPWIVQQIKE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177 6/17 (35%)
Tryp_SPc 179..422 CDD:238113 78/254 (31%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 77/249 (31%)
Tryp_SPc 50..280 CDD:214473 75/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.