DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG32376

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:249 Identity:76/249 - (30%)
Similarity:127/249 - (51%) Gaps:34/249 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   178 KIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRS 242
            :|:.|:.......|:..::   |..|  .:|||..:|:..|:::|.|||...|:|  |.|     
  Fly    65 RIVNGKRIPCTEAPFQGSL---HYEG--YFVCGCVIINKIWILTAHHCFFGPPEK--YTV----- 117

Human   243 RLNSNTQ---GEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKE--GRCAQPSRTIQTICLPS 302
            |:.|:.|   |::: .|:.::....|:..|:.|  |:|::|::|..  |:|.:|      :.|||
  Fly   118 RVGSDQQRRGGQLR-HVKKIVALAAYNDYTMRH--DLAMMKLKSPVYFGKCVRP------VKLPS 173

Human   303 MYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPH-YYGSEVTTKMLCAADPQ 366
            . ...:|.....::|:|..::........|:...:..|...:||:.: ..|.::...|:||:  :
  Fly   174 T-KTTKFPKKFVVSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICAS--R 235

Human   367 WKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR 420
            ...|||.|||||||.    .|..|.||||||.|||.|:.||||.....::|||:
  Fly   236 TNKDSCSGDSGGPLT----SRGVLYGIVSWGIGCANKNYPGVYVNCKRYVPWIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177
Tryp_SPc 179..422 CDD:238113 76/248 (31%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 74/246 (30%)
Tryp_SPc 66..287 CDD:238113 76/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.