DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG33459

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:278 Identity:77/278 - (27%)
Similarity:120/278 - (43%) Gaps:52/278 - (18%)


- Green bases have known domain annotations that are detailed below.


Human   164 LKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID 228
            |:..|||...|.|  |.||....:.:.||.|.::..     :.::||||||:..:|::|.||.:.
  Fly    25 LEPNCGQIPFRMR--IFGGMDAGLVSTPWMAFLHNH-----LQFLCGGSLITSEFVLTAAHCVMP 82

Human   229 YPKKEDYIVYLGR-------SRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEG 286
            .||  :..|.||.       ..:|...: ..::.|..:..|..|.  ::|.: ||||||:    .
  Fly    83 TPK--NLTVRLGEYDWTRQMDSINPKHR-HREYMVTRIYTHPSYR--SIAAY-DIALLKL----N 137

Human   287 RCAQPSRTIQTIC--LPSMYND--------PQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLIS 341
            :..:.:..|:.||  ||..:::        ..|    .:||:|...:..  ..:.|:...:..|.
  Fly   138 QTVEYTVAIRPICLVLPENFHEWYWLVDSVEDF----TLTGWGATKTEP--VSQVLQSANLTQID 196

Human   342 HRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCS-LQGRMTL---TGIVSWG-RGCA 401
            ...|..  .||..|....:||...  |:.:|.||||.||... :..|..:   .||||.| :.| 
  Fly   197 RGTCHD--RYGHSVDHTHICAGSS--KSFACVGDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNC- 256

Human   402 LKDKPGVYTRVSHFLPWI 419
              |...|:|.|..|..||
  Fly   257 --DGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056
Connecting peptide 152..177 5/12 (42%)
Tryp_SPc 179..422 CDD:238113 71/263 (27%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 70/264 (27%)
Tryp_SPc 38..272 CDD:238113 69/261 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.