DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAU and CG30088

DIOPT Version :9

Sequence 1:NP_002649.2 Gene:PLAU / 5328 HGNCID:9052 Length:431 Species:Homo sapiens
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:318 Identity:87/318 - (27%)
Similarity:132/318 - (41%) Gaps:76/318 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   133 CYV---QVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFA 194
            |.|   ||....|:..|.|                .::....|     :|:.|:...:::.|:.|
  Fly    17 CLVLQEQVAANFLIPSCGV----------------SYESNVAT-----RIVRGKEAMLKSAPFMA 60

Human   195 AIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRL--NSNTQG---EMKF 254
            .:|.     |....|||::||..::::|.||...|.|     |.||...:  |.:.||   ....
  Fly    61 YLYY-----SSEIHCGGTIISSRYILTAAHCMRPYLK-----VRLGEHDITRNPDCQGGSCSPPA 115

Human   255 EVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL-------PSMYNDPQFGTS 312
            |..:::|...|........|||||||:    .|..:.:..||.|||       |:::....||..
  Fly   116 EEFDIVLATKYKRFDRFLANDIALLKL----SRNIRFNVHIQPICLILNPAAAPNVHEFQAFGWG 176

Human   313 CEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSG 377
                    :..|:: ....|:.||:....:|.|:.  .....:|...||....  .:|:|.||||
  Fly   177 --------QTETNH-SANVLQTTVLTRYDNRHCRS--VLSMPITINQLCVGFQ--GSDTCSGDSG 228

Human   378 GPLVCSLQ----GRMTLTGIVSWGRGCALKDK---PGVYTRVSHFLPWIRSHTKEENG 428
            ||||..:.    .|....||||:|     .||   |||||.|.:::.||| :..:.||
  Fly   229 GPLVTKVNYDGVWRYLQLGIVSFG-----DDKCQSPGVYTYVPNYIRWIR-YVMQSNG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLAUNP_002649.2 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 34..57
KR 67..152 CDD:238056 7/21 (33%)
Connecting peptide 152..177 1/24 (4%)
Tryp_SPc 179..422 CDD:238113 77/261 (30%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 74/259 (29%)
Tryp_SPc 45..273 CDD:238113 75/259 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.