DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PLAT and gammaTry

DIOPT Version :9

Sequence 1:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:256 Identity:81/256 - (31%)
Similarity:120/256 - (46%) Gaps:31/256 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   307 PQF--RIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLT 369
            ||.  ||.||....|:|.|||.::    :||....  |||.:.||..|::||||.|. .....|.
  Fly    25 PQLDGRIVGGSATTISSFPWQISL----QRSGSHS--CGGSIYSSNVIVTAAHCLQS-VSASVLQ 82

Human   370 VILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPA 434
            :..|.:|....|   ..|.|..:..|:.::.:|..||||::::..    ....||.::.:.|  |
  Fly    83 IRAGSSYWSSGG---VTFSVSSFKNHEGYNANTMVNDIAIIKING----ALTFSSTIKAIGL--A 138

Human   435 DLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRC-TSQHLLNRTVTDNMLCAGDTRS 498
            .....:.....:||:|.....|.....:|:..:|.:...|:| :|.:.....:...|:||.    
  Fly   139 SSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA---- 199

Human   499 GGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDN 559
                |:..||||||||||||  :.|  .|||::|||.||...:.||||..|.....|:..|
  Fly   200 ----ASGKDACQGDSGGPLV--SGG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PLATNP_000921.1 FN1 41..83 CDD:214494
Important for binding to annexin A2 42..52
KR 125..209 CDD:238056
Kringle 215..296 CDD:306546
Tryp_SPc 313..559 CDD:238113 76/246 (31%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 77/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.