DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PKNOX1 and vis

DIOPT Version :10

Sequence 1:NP_004562.2 Gene:PKNOX1 / 5316 HGNCID:9022 Length:436 Species:Homo sapiens
Sequence 2:NP_788337.1 Gene:vis / 36372 FlyBaseID:FBgn0033748 Length:524 Species:Drosophila melanogaster


Alignment Length:85 Identity:37/85 - (43%)
Similarity:57/85 - (67%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   242 QLQLNQDLSI---LHQD-DGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLT 302
            |:|...|:.:   .|.| :||.:.:||.|||.:..:::.||::|..:.||::.||..::.:.|||
  Fly    70 QVQNYHDMMVDSEHHVDINGSLRKRRGNLPKSSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLT 134

Human   303 LLQVNNWFINARRRILQPML 322
            :|||.|||||||||||..|:
  Fly   135 VLQVCNWFINARRRILPEMI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PKNOX1NP_004562.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Meis_PKNOX_N 80..165 CDD:465140
Homeobox_KN 278..316 CDD:428673 19/37 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..436
visNP_788337.1 Homeobox_KN 110..148 CDD:428673 19/37 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.