DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PKNOX1 and CG11617

DIOPT Version :10

Sequence 1:NP_004562.2 Gene:PKNOX1 / 5316 HGNCID:9022 Length:436 Species:Homo sapiens
Sequence 2:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster


Alignment Length:169 Identity:47/169 - (27%)
Similarity:68/169 - (40%) Gaps:54/169 - (31%)


- Green bases have known domain annotations that are detailed below.


Human   252 LHQDDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRR 316
            ||  ..|...||...| ....:::.||.:...:|||:.:||||:||:|.||..|:.|||.|.||:
  Fly    24 LH--PASRATKRLFTP-DIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRK 85

Human   317 ILQPMLDSSCSETPKTKKKTAQNRPVQRFWPDSI------ASGVAQPPPSELTMSEGAVVTITTP 375
            :..       ||..|.||.          |...|      |.|                      
  Fly    86 LKN-------SEREKAKKS----------WGHLIKNYNHNARG---------------------- 111

Human   376 VNMNVDSLQSLSSDGATLAVQQVMMAGQSEDESVDSTEE 414
               ||:.. |:||:.:..  ::.|.:..:||:..|..||
  Fly   112 ---NVEQF-SISSEDSIW--EEEMHSCPAEDDEGDDNEE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PKNOX1NP_004562.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Meis_PKNOX_N 80..165 CDD:465140
Homeobox_KN 278..316 CDD:428673 19/37 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..436 5/14 (36%)
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 24/68 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.