DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PKD2 and brv2

DIOPT Version :9

Sequence 1:NP_000288.1 Gene:PKD2 / 5311 HGNCID:9009 Length:968 Species:Homo sapiens
Sequence 2:NP_648970.2 Gene:brv2 / 39932 FlyBaseID:FBgn0036712 Length:736 Species:Drosophila melanogaster


Alignment Length:728 Identity:169/728 - (23%)
Similarity:280/728 - (38%) Gaps:143/728 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   157 REDQGPPCPSPVGGGDPLHRHLPLEGQPPRVAWAERLVRGLRGLWGTRLMEESSTN---REKYLK 218
            :||  ||..:..||  |...|:..            |...||.|....|:.|..||   .:|| |
  Fly    76 QED--PPYRAEEGG--PTMDHIGY------------LKIRLRSLRSELLISEGHTNEMLNQKY-K 123

Human   219 SVLRELVTYLLFLIVLCILTYGMMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFT 283
            .:..:|:.|..:.|.|.::.........||.|..|.:||.|........:....:..:..:.|.|
  Fly   124 HIAGDLLLYGSYFIALMLMVVLQEDHTNYYNTNNMQRLFWDNTSVTFGLSQVYFIYQVHSYMKIT 188

Human   284 EGSLLDGLY----------WKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLR 338
               |::..|          |.|:...:               :||.|:||:|        |.|..
  Fly   189 ---LVEAFYAQKTNGYEGWWAMEQWQK---------------IGVVRLRQMR--------PVDCH 227

Human   339 DEI-KECYDVYSVSSEDRAPFGPRNGTA--W-IYT-------SEKDLNG----SSHWGIIATY-S 387
            ..: |..:|..:.:.|.|.|:...:.|.  | ||.       ....|||    ..|:|.:..| .
  Fly   228 IGLGKPEWDKKTYAPEWRLPYHRMHYTEKFWRIYDPFVPAEFEPSFLNGLLLNYDHYGYLLNYPE 292

Human   388 GAGYYLDLSRTREETAAQVASLKKNVWLDRGTRATFIDFSVYNANINLFCVVRLLVEFPATGGVI 452
            .|||.:.:..|:.....|:..|:...|||:.|.|.|||.::|||:.|||.::.|.||....|..:
  Fly   293 VAGYVVLMMSTKINCLKQIEYLRDYSWLDKNTSALFIDLTMYNADANLFTLITLRVENSPFGIQL 357

Human   453 PSWQFQPLKLIRYVTTFDFFLAACEIIFCFFIFYYVVEEILEIR------IHKLHYFRSFWNCLD 511
            |......:.::..|.|    .:..|::   .:|.|.|..||..|      .|........|..:|
  Fly   358 PRVHVDSVSMLGNVET----RSNSELL---ILFVYTVLVILFARGVFTKIWHHPAAAHEAWTMVD 415

Human   512 VVIVVLSVVAIGINIYRTSNVEVLLQFLE--DQNTFPNFEH-LAYWQIQFNNIAAVTVFFVWIKL 573
            :.|.:|:|....:.|.|....:.|||.:|  .:..:.:|:. |...|:.| .:....|....::|
  Fly   416 LAIYILNVFLTVLAIMRDIETDALLQIIETATKGQYLDFQRPLRLHQMLF-IVKGFLVCITTLRL 479

Human   574 FKFINFNRTMSQLSTTMSRCAKDLFGFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFR 638
            :|.:.|.......:.|:....:.:....::..::.:|......:..|.....||...:.:.|...
  Fly   480 WKVLQFASVFQHFTQTLFSAWRAVASLGVIILVVLMAIGITLAVPNGNNAVVFSHMVQSVVTCMW 544

Human   639 IIL---GDINFAEIEEANRVLGPIYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQK----- 695
            ..:   |||:.|:.....|:||.:.:...||.:..||:|:|.::|.|.::|....|.:..     
  Fly   545 YSMGFNGDIHPADFFHGGRILGILLYLALVFLLAIILMNVFASVIYDYFNETSRILKEHSNRSSI 609

Human   696 -----AEMELSDL-------IRKGY----HKALVKLKLKKNTVDDISESLRQGGGKLNFDELR-- 742
                 ..:|.:||       :||.|    |.....::|:.|..:.|         |...|.::  
  Fly   610 TFLEFLHVEYADLFGDAFRCLRKTYESRGHTVAENVELELNRRELI---------KFKRDLIKSP 665

Human   743 QDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRDDLEKEREDL------DLDHSSLPRPMS 801
            |:||         .|:.|:..:..|..|...:..::...|..:.|.|      |.| ..||.|.:
  Fly   666 QELK---------RALLTEEQRSADYRLRGEKLFKLMAILNLQVEILERMVLGDKD-GKLPTPPA 720

Human   802 SRSFPRSLDDSEE 814
            |.|.|   ||..|
  Fly   721 SDSDP---DDMPE 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PKD2NP_000288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..181 8/23 (35%)
PKD_channel 269..687 CDD:400395 104/455 (23%)
Selectivity filter. /evidence=ECO:0000305|PubMed:28092368 641..643 0/4 (0%)
EFh_HEF <724..792 CDD:355006 14/75 (19%)
EF-hand motif 754..782 CDD:320075 4/27 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..831 16/57 (28%)
Linker. /evidence=ECO:0000305|PubMed:18694932 803..822 5/12 (42%)
Important for interaction with PACS1 and PACS2. /evidence=ECO:0000269|PubMed:15692563 810..821 3/5 (60%)
Fer4_24 834..868 CDD:407943
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 917..968
brv2NP_648970.2 PKD_channel 169..596 CDD:285288 104/460 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.