DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PKD1 and Lrt

DIOPT Version :9

Sequence 1:XP_024306066.1 Gene:PKD1 / 5310 HGNCID:9008 Length:4343 Species:Homo sapiens
Sequence 2:NP_001286640.1 Gene:Lrt / 37342 FlyBaseID:FBgn0034540 Length:830 Species:Drosophila melanogaster


Alignment Length:202 Identity:58/202 - (28%)
Similarity:93/202 - (46%) Gaps:16/202 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    44 GAACRVNCSGRGLRTLGPA-LRIPADATALDVSHNLLRALDVGLLANLSALAELDISNNKISTLE 107
            ||...::.|..|:..:..| |:..:..|.||::||.||||...|:|.|.:|.||.::.|.||.:.
  Fly   394 GALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPLPSLRELRLAGNDISIVA 458

Human   108 EGIFANLFNLSEINLSGNPFECDCGLAWLPRWAEEQQVRVVQPEAATCAGPGSLAGQPLLGIPLL 172
            .........|..:.:..||..|||.:.....|.:|.|:.  ...:|:|..|..|.|.|||.:|:.
  Fly   459 RNAMDGARELESLQMQENPLSCDCSIRPFAEWLQESQLH--SSLSASCVTPPRLEGAPLLQVPVE 521

Human   173 DSGCGEEYVACLPDNSS-----GTVAAVSFSAAHEGLLQPEACSAFCFSTGQGLAA-----LSEQ 227
            ...|..:.|.  .||::     .|:|..:.::..:.|.:........|||..||..     ||::
  Fly   522 TLSCDMDNVE--KDNANIMQHLETLAKPNQTSPIKDLSEEIILHELHFSTDYGLILTWLLNLSKK 584

Human   228 GWCLCGA 234
            .: :|.|
  Fly   585 DY-MCDA 590

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PKD1XP_024306066.1 LRR <50..>126 CDD:227223 23/76 (30%)
leucine-rich repeat 70..92 CDD:275378 12/21 (57%)
leucine-rich repeat 93..116 CDD:275378 6/22 (27%)
PCC 97..2768 CDD:188093 37/148 (25%)
leucine-rich repeat 117..129 CDD:275378 3/11 (27%)
GPS 3051..3100 CDD:197639
PLAT_polycystin 3158..3277 CDD:238850
PKD_channel 3751..4153 CDD:332708
LrtNP_001286640.1 LRR_RI <151..334 CDD:238064
leucine-rich repeat 179..199 CDD:275378
leucine-rich repeat 200..223 CDD:275380
leucine-rich repeat 225..248 CDD:275380
LRR_8 249..307 CDD:290566
leucine-rich repeat 249..272 CDD:275380
LRR_RI <270..479 CDD:238064 27/84 (32%)
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..322 CDD:275380
LRR_8 322..382 CDD:290566
leucine-rich repeat 323..347 CDD:275380
leucine-rich repeat 348..371 CDD:275380
LRR_8 370..428 CDD:290566 9/33 (27%)