DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PKD1 and Pkd2

DIOPT Version :9

Sequence 1:XP_024306066.1 Gene:PKD1 / 5310 HGNCID:9008 Length:4343 Species:Homo sapiens
Sequence 2:NP_609561.2 Gene:Pkd2 / 34651 FlyBaseID:FBgn0041195 Length:924 Species:Drosophila melanogaster


Alignment Length:547 Identity:116/547 - (21%)
Similarity:200/547 - (36%) Gaps:115/547 - (21%)


- Green bases have known domain annotations that are detailed below.


Human  3784 LGPPRLRQVRL-QEALYPDPPGPR-VHTCSAAGGFSTSDYDVGWES---PHNGSGTWAYSAP--- 3840
            ||||||||:|: :|:.|.:....| .:||.||       |..|.|.   .|.||       |   
  Fly   435 LGPPRLRQIRVRKESCYVNDAFIRYFNTCYAA-------YSSGAEDRKPMHKGS-------PFRT 485

Human  3841 --DLLGAWSWGSCAVYDSGGYVQELGLSLEESRDR----LRFLQLHNWLDNRSRAVFLELTRYSP 3899
              ||.....|...|.|.:|||.    ::|:..:||    :..|:..:|||..||...:|...::.
  Fly   486 MHDLDSTPIWTVLAFYRTGGYT----VNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLFNE 546

Human  3900 AVGLHAAVTLRLEFPAAGRALAALSVRPFALRRLSAGLSLPLLTSVCLL--LFAVHFAVAEARTW 3962
            ...:..::.|..|.|..|..:....::...:.......|: |:|.:.:.  :..:::.:.|....
  Fly   547 NTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSM-LMTVIYIFWYIMVIYYTIYEITEI 610

Human  3963 HRE-------------------GRWRVLRLGAWARWLLVALTAATALVRLAQLGAADRQWTRFVR 4008
            .:.                   |.:..|....|..:.:::|||           .|....|    
  Fly   611 RKSGIKIYFCSMLNILDCAILLGCYLALVYNIWHSFKVMSLTA-----------RAHSDVT---- 660

Human  4009 GRPRRFTSFDQVAQLSSAARGLAASLLFLLLVKAAQQLRFVRQWSVFGKTLCRALPELLGVTLGL 4073
                 :.|.|.:...:.....:.|.|.||:.:|..:.:.|.:....|..||.|...:|.|.:|..
  Fly   661 -----YQSLDVLCFWNIIYVDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMF 720

Human  4074 VVLGVAYAQLAILLVS-------SCVDSLWSVAQALLVLCPGTGLSTLCPAESWHLSPLLCVGLW 4131
            .::.:|||||.:||..       :.:.|:.::.:.:|    |.....|....:..|.|:..:...
  Fly   721 GIVFLAYAQLGLLLFGTKHPDFRNFITSILTMIRMIL----GDFQYNLIEQANRVLGPIYFLTYI 781

Human  4132 ALRLWGALRLGAVILRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLWMGLSKVKEFRHKVRFE 4196
            .|..:..|.:...|:...|:.::||:.:.......|  :...|..:..|:.....|...|     
  Fly   782 LLVFFILLNMFLAIIMETYNTVKGEITQGRSHLGSY--IYRKLSGMLYWITHCGRKRRHH----- 839

Human  4197 GMEPLPSRSSRGSK-VSPDVPPPSAGSDASHP----STSSSQL------DGLSVSLGRLGTRCEP 4250
                 |..|....| ...||   .|..|.:|.    .|.:.|.      .|.:..:.||..|.  
  Fly   840 -----PQASETEDKDAEHDV---GAAHDETHEIRKNMTPAEQQYFKDIPQGENQDMVRLNNRV-- 894

Human  4251 EPSRLQAVFEALLTQFDRLNQATEDVY 4277
              ..|:.:.|.|:...|.:.:..|..|
  Fly   895 --GLLEEILEKLINNMDDILKRVEKDY 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PKD1XP_024306066.1 LRR <50..>126 CDD:227223
leucine-rich repeat 70..92 CDD:275378
leucine-rich repeat 93..116 CDD:275378
PCC 97..2768 CDD:188093
leucine-rich repeat 117..129 CDD:275378
GPS 3051..3100 CDD:197639
PLAT_polycystin 3158..3277 CDD:238850
PKD_channel 3751..4153 CDD:332708 89/410 (22%)
Pkd2NP_609561.2 PKD_channel 402..803 CDD:285288 89/410 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151821
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.