DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PITX3 and Ptx1

DIOPT Version :9

Sequence 1:NP_005020.1 Gene:PITX3 / 5309 HGNCID:9006 Length:302 Species:Homo sapiens
Sequence 2:NP_001138130.2 Gene:Ptx1 / 43664 FlyBaseID:FBgn0020912 Length:610 Species:Drosophila melanogaster


Alignment Length:278 Identity:120/278 - (43%)
Similarity:154/278 - (55%) Gaps:60/278 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    50 GGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRR 114
            |..|::....|:|||||||||||||||||.||.||||||||||||||:|||||||||||||||||
  Fly   252 GEEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDMSTREEIAMWTNLTEARVRVWFKNRR 316

Human   115 AKWRKRER-SQQAELCKGSFAAPLG-GLVPPY--EEVYPGYSYGNWPPKALAPPLAAKTFPFAFN 175
            |||||||| :..|.:....|.:..| ..:.|:  :.:|..|.|.||  ..:..||..|.||:..|
  Fly   317 AKWRKRERNAMNAAVAAADFKSGFGTQFMQPFADDSLYSSYPYNNW--TKVPSPLGTKPFPWPVN 379

Human   176 SVNVGPLASQPV----------FSPPSSIAASMVPSAAAAPGTVPGPGALQGLGGGPPGLAPAAV 230
                 ||.|...          |:..:|..|..:.:|:..||::              |.:.:..
  Fly   380 -----PLGSMVAGNHHQNSVNCFNTGASGVAVSMNNASMLPGSM--------------GSSLSNT 425

Human   231 SS-GAVS--CPYASAAAAAAAAASSPYVYR---DPC-----NSSLASLRLKAKQHASFSYPAVHG 284
            |: |||.  |||.:.|        :||:||   :||     :||:|:||||||||||..:.:.:.
  Fly   426 SNVGAVGAPCPYTTPA--------NPYMYRSAAEPCMSSSMSSSIATLRLKAKQHASAGFGSPYS 482

Human   285 PPP------AANLSPCQY 296
            .|.      :|.||.|||
  Fly   483 APSPVSRSNSAGLSACQY 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PITX3NP_005020.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..71 11/20 (55%)
Homeobox 66..119 CDD:395001 49/52 (94%)
OAR 258..275 CDD:397759 12/21 (57%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 262..275 10/12 (83%)
Nuclear localization signal. /evidence=ECO:0000255 268..272 3/3 (100%)
Ptx1NP_001138130.2 Homeobox 268..320 CDD:278475 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5957
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3670
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1432356at2759
OrthoFinder 1 1.000 - - FOG0001767
OrthoInspector 1 1.000 - - otm40595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45882
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.