DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PITX2 and Antp

DIOPT Version :10

Sequence 1:NP_000316.2 Gene:PITX2 / 5308 HGNCID:9005 Length:324 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:103 Identity:35/103 - (33%)
Similarity:49/103 - (47%) Gaps:10/103 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    73 SQQGKNEDVGAEDP---------SKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVW 128
            ||...::..|...|         .|.:.::|.|..:|..|..|||..|..|||.....|.|||..
  Fly   269 SQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHA 333

Human   129 TNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQ 166
            ..|||.::::||:|||.|| |:|...:.|....|.|.:
  Fly   334 LCLTERQIKIWFQNRRMKW-KKENKTKGEPGSGGEGDE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PITX2NP_000316.2 Homeodomain 93..149 CDD:459649 25/55 (45%)
OAR 282..299 CDD:461067
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 7/36 (19%)
Homeodomain 298..354 CDD:459649 25/56 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.