DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PITX1 and ey

DIOPT Version :9

Sequence 1:NP_002644.4 Gene:PITX1 / 5307 HGNCID:9004 Length:314 Species:Homo sapiens
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:124/287 - (43%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     9 SLERLPEGLRP--PPPPPHDMGPAFHLARPADPREPLENSASESSDTELP--------EKERGGE 63
            ||..:|....|  .....:..||:  ||....|...:|:.||.......|        :||..|.
  Fly   373 SLSEIPISSAPNIASVTAYASGPS--LAHSLSPPNDIESLASIGHQRNCPVATEDIHLKKELDGH 435

Human    64 PKGPEDSGAGGTGCGGA-------DDPAK---KKKQRRQRTHFTSQQLQELEATFQRNRYPDMSM 118
            ......||.|....|||       ||.|:   |:|.:|.||.||:.|:..||..|:|..|||:..
  Fly   436 QSDETGSGEGENSNGGASNIGNTEDDQARLILKRKLQRNRTSFTNDQIDSLEKEFERTHYPDVFA 500

Human   119 REEIAVWTNLTEPRVRVWFKNRRAKWRKRE--RNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSY 181
            ||.:|....|.|.|::|||.|||||||:.|  |||:       ..|..:|         |:..|.
  Fly   501 RERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQR-------RTPNSTG---------ASATSS 549

Human   182 NNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSA----PSSISSMTMPSSMGPGAVPGMPNSGL 242
            :..|..||..:|         ||:|..||....||    .|:|:.::.||::.            
  Fly   550 STSATASLTDSP---------NSLSACSSLLSGSAGGPSVSTINGLSSPSTLS------------ 593

Human   243 NNINNLT-GSSLNSAMSPGACPYGTPA 268
            .|:|..| |:.::|:.||...|:..|:
  Fly   594 TNVNAPTLGAGIDSSESPTPIPHIRPS 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PITX1NP_002644.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..103 33/113 (29%)
COG5576 36..>146 CDD:227863 47/127 (37%)
Homeobox 93..146 CDD:395001 27/52 (52%)
Interaction with PIT-1. /evidence=ECO:0000250 147..279 32/129 (25%)
OAR 276..293 CDD:397759
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 280..293
Nuclear localization signal. /evidence=ECO:0000255 286..290
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 26/51 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.