DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PITX1 and Pph13

DIOPT Version :10

Sequence 1:XP_047273274.1 Gene:PITX1 / 5307 HGNCID:9004 Length:348 Species:Homo sapiens
Sequence 2:NP_477330.1 Gene:Pph13 / 33239 FlyBaseID:FBgn0023489 Length:357 Species:Drosophila melanogaster


Alignment Length:187 Identity:72/187 - (38%)
Similarity:91/187 - (48%) Gaps:32/187 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   115 DDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWR 179
            |....|:||||.||.|.:.||||||..|||..|||:..|||:||..:|||.||:|||:|||||||
  Fly     2 DKGTMKRKQRRYRTTFNTLQLQELERAFQRTHYPDVFFREELAVRIDLTEARVQVWFQNRRAKWR 66

Human   180 KRERNQQLDLCKGGYVPQFSGLVQPY-EDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLS 243
            |:|:              ..||...| |.......||::.|......:.|.... |......|.|
  Fly    67 KQEK--------------IGGLGGDYKEGALDLDVSYDDSAVLGQLDSALGGGG-TLLPDTPPQS 116

Human   244 SQSMFSAPSSISSMTMPSSMGPGAV-PG--MPNSGLN-NINNL----TGSSLNSAMS 292
            |.|:        ...:.:|.|.||: |.  .||..|| ||::|    .||.|:...|
  Fly   117 SNSL--------DNELKASYGTGAMSPSRLSPNIFLNLNIDHLGLERGGSGLSMEWS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PITX1XP_047273274.1 Homeodomain 124..180 CDD:459649 36/55 (65%)
OAR 310..327 CDD:461067
Pph13NP_477330.1 Homeodomain 11..67 CDD:459649 36/55 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.