Sequence 1: | XP_011507936.1 | Gene: | PI4KB / 5298 | HGNCID: | 8984 | Length: | 849 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260427.1 | Gene: | Tor / 47396 | FlyBaseID: | FBgn0021796 | Length: | 2471 | Species: | Drosophila melanogaster |
Alignment Length: | 325 | Identity: | 70/325 - (21%) |
---|---|---|---|
Similarity: | 128/325 - (39%) | Gaps: | 94/325 - (28%) |
- Green bases have known domain annotations that are detailed below.
Human 520 RRLSEQLAHTPTAFKRDPEDPSAVALKE----------PWQEKVR-------------------- 554
Human 555 --RIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQE----RVPLWIKPYKIL 613
Human 614 VISADSGMIEPVVNAVSIHQV-------KK----QSQLSLLDY--------FLQ-----EHG--- 651
Human 652 -------------SYTTEAFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLD-AEGHIIHIDF 702
Human 703 GFILSSSPRNLGF-ETSAFKLTTEFVDVM--GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVE 764
Human 765 764 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PI4KB | XP_011507936.1 | PI4Kc_III_beta | 541..849 | CDD:270712 | 65/304 (21%) |
Tor | NP_001260427.1 | TEL1 | 308..2471 | CDD:227365 | 70/325 (22%) |
HEAT repeat | 632..658 | CDD:293787 | |||
HEAT repeat | 668..698 | CDD:293787 | |||
HEAT repeat | 706..736 | CDD:293787 | |||
HEAT repeat | 749..780 | CDD:293787 | |||
HEAT repeat | 798..823 | CDD:293787 | |||
DUF3385 | 831..999 | CDD:288698 | |||
HEAT repeat | 841..870 | CDD:293787 | |||
HEAT repeat | 880..917 | CDD:293787 | |||
HEAT repeat | 925..954 | CDD:293787 | |||
Rapamycin_bind | 1937..2034 | CDD:285924 | 0/2 (0%) | ||
PIKKc_TOR | 2075..2353 | CDD:270713 | 60/280 (21%) | ||
FATC | 2440..2471 | CDD:280430 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |