DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PI4KB and Pi3K68D

DIOPT Version :9

Sequence 1:XP_011507936.1 Gene:PI4KB / 5298 HGNCID:8984 Length:849 Species:Homo sapiens
Sequence 2:NP_001163420.1 Gene:Pi3K68D / 39329 FlyBaseID:FBgn0015278 Length:1876 Species:Drosophila melanogaster


Alignment Length:536 Identity:118/536 - (22%)
Similarity:212/536 - (39%) Gaps:135/536 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   365 ISELSLLNHKLP-ARV------WLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFD 422
            :..|.||..:.| |:|      |         :.::|:.|.|     |..|.|  |:.|:.:.::
  Fly  1109 LQSLELLLPRYPDAKVREKAVEW---------ISKMPNDQLV-----DFLPQL--VQSLKHDTYE 1157

Human   423 TTSVPARIPENRIRSTR--------SVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDI--- 476
            .:::...:....:.|.|        .|.:||:   ......|:......||..    .|..:   
  Fly  1158 GSAMARFLLSKCLESPRFAHHMYWLLVHSLPD---DPHNSIGAAMVDQEYDES----QVTQVRYY 1215

Human   477 --------------GELQVELPEVHTNSCDNISQFSVDSITSQESKEPVFIAAG--DIRRRLSEQ 525
                          ||..::........|..::..:.....::||.....:|||  ::.:.|.||
  Fly  1216 RRNKMMLRALMAICGEKMLQRFMYQHRMCQKLTTIAESVKEAKESMRQKSLAAGMDEVHQDLLEQ 1280

Human   526 LAHTPTAFKRDPE-DPSAVALKE---------PWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDD 580
                ||.....|| :.:.|:::.         |.  |:..:.        |:...|..|.|||||
  Fly  1281 ----PTCLPLGPELEVTGVSVRNCSYFNSNTLPL--KINFVG--------PDAESLPAIFKCGDD 1331

Human   581 LRQELLAFQVLKQLQSIWEQERVPLWIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDY 645
            |:|:.|..|:::.:..:|..||:.|.:..:..:.....|||||.|..|.::.:::.:..|:    
  Fly  1332 LQQDQLTIQLIRIMNKMWLAERLDLKMVTFNCVPTGYKSGMIELVSEAETLRKIQVECGLT---- 1392

Human   646 FLQEHGSYTTE--------------AFLSAQRNFVQSCAGYCLVCYLLQVKDRHNGNILLDAEGH 696
                 ||:...              .:.||.|||..|||||.:..|:|.:.||||.||:|...||
  Fly  1393 -----GSFKDRPIAEWLGKQNPSPLEYQSAVRNFTLSCAGYSVATYVLGICDRHNDNIMLKTSGH 1452

Human   697 IIHIDFGFILSSSPR--NLGFETSAFKLTTEFVDVMGGLDGDM----FNYYKMLMLQGLIAARKH 755
            :.|||||..|..:..  |...:.:.|.||::...|:.|  ||.    |:|:..|..:.....||:
  Fly  1453 LFHIDFGKFLGDAQMFGNFKRDRTPFVLTSDMAYVING--GDKPSTDFHYFVDLCCRAFNIVRKN 1515

Human   756 MDKVVQIVEIMQQGCRRCSGSSPSGPMMTVAQVICSQLPCFHGSSTIRNLKERFHMSMTEEQLQL 820
            .|.::.                      |:|.:..:.:|..: |:.::.::.....|.:..:...
  Fly  1516 ADLLLH----------------------TLAHMATAGMPGVN-SNAVQYVRRALLPSQSNPEAAA 1557

Human   821 LVEQMVDGSMRSITTK 836
            ...:|:..|::|..|:
  Fly  1558 TFAKMIQSSLKSWFTQ 1573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PI4KBXP_011507936.1 PI4Kc_III_beta 541..849 CDD:270712 79/325 (24%)
Pi3K68DNP_001163420.1 EIN3 <58..392 CDD:296674
PI3K_rbd 561..669 CDD:197540
C2A_PI3K_class_II 844..1021 CDD:175979
PI3Ka_II 1038..1202 CDD:238441 21/111 (19%)
PI3Kc_II 1235..1583 CDD:270710 92/387 (24%)
PX_PI3K_C2_68D 1611..1721 CDD:132794
C2B_PI3K_class_II 1751..1871 CDD:176027
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.