DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PI4KB and CG30184

DIOPT Version :9

Sequence 1:XP_011507936.1 Gene:PI4KB / 5298 HGNCID:8984 Length:849 Species:Homo sapiens
Sequence 2:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster


Alignment Length:240 Identity:46/240 - (19%)
Similarity:71/240 - (29%) Gaps:74/240 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   133 QNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQ-------AYIGNRLFCFRNEDVDFYLPQ 190
            |..|.|..|.|......|..:...:.:.....|.||.       .|.|:.:.||.:....||..:
  Fly     2 QVRSKKPVWFLFKMMELLLSLGCCLVHWTCFMEEGVPHIFLLCGTYGGSVIICFISLIGAFYAER 66

Human   191 ---------------------LLNMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCA---LLLGAY 231
                                 ..|||:...|:......|.....||.:...:|...   |:...:
  Fly    67 PTMKHEALFGGILGGLHMVTVYANMYVATLEEFRTERWPSFYACCRDNAIVALYAGAIYLMHCTF 131

Human   232 SSDMHISTQRHSRGTKLRKLILSDELKPAH---------------------RKRELPSLSPAPDT 275
            :.|:..|   |||....:|:......:|..                     ..|.|.|..|:..:
  Fly   132 ALDLMFS---HSRSRANQKMHPQRSKRPLQLYFISRGAEAYLSRFWFFRRIAARMLTSAQPSEHS 193

Human   276 GLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVENEDEELSSS 320
            |   .||....|:||:.|.                |.|:|.:.:|
  Fly   194 G---RKRQVSSSESDSDAK----------------EREEERIRNS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PI4KBXP_011507936.1 PI4Kc_III_beta 541..849 CDD:270712
CG30184NP_726341.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.