DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIK3CD and CG30184

DIOPT Version :9

Sequence 1:XP_016856965.1 Gene:PIK3CD / 5293 HGNCID:8977 Length:1103 Species:Homo sapiens
Sequence 2:NP_726341.1 Gene:CG30184 / 246506 FlyBaseID:FBgn0050184 Length:223 Species:Drosophila melanogaster


Alignment Length:43 Identity:10/43 - (23%)
Similarity:19/43 - (44%) Gaps:14/43 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   246 RHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDE 288
            :||.|:|.            :..||  |:..|:::..:|..:|
  Fly    70 KHEALFGG------------ILGGL--HMVTVYANMYVATLEE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIK3CDXP_016856965.1 PI3K_p85B 32..107 CDD:308030
PI3K_rbd 175..281 CDD:307097 8/34 (24%)
C2_PI3K_class_I_beta_delta 314..481 CDD:176075
PI3Ka 562..743 CDD:214537
PI3Kc_IA_delta 735..1101 CDD:270718
CG30184NP_726341.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.