DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINI2 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001012303.2 Gene:SERPINI2 / 5276 HGNCID:8945 Length:405 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:396 Identity:123/396 - (31%)
Similarity:200/396 - (50%) Gaps:36/396 - (9%)


- Green bases have known domain annotations that are detailed below.


Human     4 IFLWSLLLLFFGSQASRCSAQKNTEFAVDLYQEVSLSH-KDNIIFSPLGITLVLEMVQLGAKGKA 67
            ||||        ..:..|...|      ::||.:|.|| ..|::.||:.|..:|.||.:||:|..
  Fly     6 IFLW--------VTSVACQTSK------EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGST 56

Human    68 QQQIRQTL----KQQETSAGEEFFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNK 128
            .::::..|    :.:|..|.....:|..    :..:::.....|||.:|:.:.:::.:.|....:
  Fly    57 AKELQSALGLPSEDKEAVAARYGALLND----LQGQEEGPILKLANRIYVNDQYSLNQNYNLAVR 117

Human   129 EFFQSAIKLVDFQDAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKF 193
            |.|:|..:.:...:....||.|:.||..:|.||||.|..........:.:|||||||||.|:.||
  Fly   118 EPFKSEAESISLTNGPVAAERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKF 182

Human   194 RKEDTQLINFTKKNGSTVKIPMMKALLRTKYGYFSESSLNYQVLELSYKGDEFSLIIILPAEGMD 258
            ....|:...|......:|.:.||..:...:..||.:  |:.||:||.|.....|:.|.||.|...
  Fly   183 DPAKTRASTFQVTANKSVPVQMMAQMGTFRANYFRD--LDAQVIELPYLNSNLSMTIFLPREVEG 245

Human   259 IEEVEKLITAQQILKWLSEMQEEEVEISLPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGI-TD 322
            :..:|     ::|:.:...:..:||.:.||:||:|.:.:.|:.|..|.|.|:|:...||||: .|
  Fly   246 LSALE-----EKIVGFARPLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELFTDKSDLSGLFAD 305

Human   323 SSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFI-ANHPFLFIMKHNPTESILFM 386
            .|...||||:.|.|.|:||:|:|||.:|.  :.|......|.|: |:|||.|:::  ...:|.|.
  Fly   306 KSGGKVSQVSHKAFLEVNEEGAEAAGATS--VAVTNRAGFSTFLMADHPFAFVIR--DANTIYFQ 366

Human   387 GRVTNP 392
            |||.:|
  Fly   367 GRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINI2NP_001012303.2 serpinI2_pancpin 23..392 CDD:381042 117/375 (31%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 115/373 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9820
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.