DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB13 and nec

DIOPT Version :9

Sequence 1:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:395 Identity:112/395 - (28%)
Similarity:179/395 - (45%) Gaps:36/395 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    10 RLGFDLFKE-LKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEK 73
            |...:|||| :|..:..|:.|||..:...:.::...:.|.|..:|::.  .|....:..:..:.:
  Fly   109 RFSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKA--GEFSKNAMAVAQDFE 171

Human    74 EVVRIKAEGKEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYH 138
            .|::.|   |.:|..:         ||..:|:..:.||...|           ..|.:|.:.|:.
  Fly   172 SVIKYK---KHLEGAD---------LTLATKVYYNRELGGVN-----------HSYDEYAKFYFS 213

Human   139 ASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKE 203
            |..|.||..||.| :..|||:||...|..||:||.....:...|:.:|||.|||:|:|:.||...
  Fly   214 AGTEAVDMQNAKD-TAAKINAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATM 277

Human   204 NTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNNDLSMFVLLPNDIDGLEKII 268
            :|....|.........|.||.....:....|.:|.|..|.:.||::..||.:||||:..||.|::
  Fly   278 DTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKML 342

Human   269 DKIS-PEKLVEWTSPGH-MEERKVNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEHKADYSGMSSG 331
            .::| ||  .:.....| :..:.|.:.||:|:.|...|:...|..:|:...|:.:......|.  
  Fly   343 QQLSRPE--FDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLMD-- 403

Human   332 SGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPGHENVH-CNHPFLFFIRHNESNSILFFG 395
            ..:...|.|..:::.|.|.||||:||:...|...|.|...... .|.||:|.:|  ...|:||.|
  Fly   404 QPVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTEFVANRPFVFAVR--TPASVLFIG 466

Human   396 RFSSP 400
            ....|
  Fly   467 HVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 111/393 (28%)
necNP_524851.1 SERPIN 108..468 CDD:238101 111/390 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.