DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB13 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:414 Identity:116/414 - (28%)
Similarity:202/414 - (48%) Gaps:65/414 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    15 LFKELKKT-NDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRI 78
            |.|::::. ..||:||||.....|:              |...|.|.::|        |:|:.:.
  Fly    45 LMKQIREIYPSGNLFFSPFSTYNAL--------------LLAYFSSSEQT--------ERELAQA 87

Human    79 KAEG-----KEIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYH 138
            ...|     :::..:..:.|:..:|....|.:    ||:..||:|.::|.....|:...:   |.
  Fly    88 LNLGWALNKQQVLVSYTLAQRQDEFRWRQSPM----ELSSANRIFVDRTINVSNKFNTLL---YG 145

Human   139 ASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWDREFKKE 203
            |:.| :||.|..:...|:||.|:..||:.:|:|:.....|:..|.|||.|..|.||||..:||.|
  Fly   146 ATKE-LDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVE 209

Human   204 NTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYK---------------NNDLSM 253
            .|..:.|::|:...:.|.||.::.:|..|..|.||::|:.:||:               .:|:||
  Fly   210 ETALKPFFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISM 274

Human   254 FVLLPNDID-GLEKIIDKISPEKLVEWTSPGHMEER----KVNLHLPRFEVEDGYDLEAVLAAMG 313
            .::|||... .|.::|.:::.:.:.:|.      ||    |:.|.||:|:.|...:|..:|:.||
  Fly   275 IIILPNSNKISLNRVISRLNADSVKKWF------ERALPQKIELSLPKFQFEQRLELTPILSLMG 333

Human   314 MGDAFSEHKADYSGMSSGS-GLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTS-APGHENVHCN 376
            :...|:.: |.:..:::.. .|......|.:.:.|.|.|:.|||||.:..:.:| .|.....:||
  Fly   334 VNTMFTRN-ATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCN 397

Human   377 HPFLFFIRHNESNSILFFGRFSSP 400
            |||:|.|...:.::|||.|.:|.|
  Fly   398 HPFVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 115/412 (28%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 114/409 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.