DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB10 and Spn88Eb

DIOPT Version :9

Sequence 1:NP_005015.1 Gene:SERPINB10 / 5273 HGNCID:8942 Length:397 Species:Homo sapiens
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:412 Identity:108/412 - (26%)
Similarity:194/412 - (47%) Gaps:56/412 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    11 FALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQ----FNRDQGVKCDPE 71
            |:|.|.|::.|.....|:|||.:|...:|.:.|..:...|..::||.|.    .|:.|.:.....
  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105

Human    72 SEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTYAFHNKYLEDMKTYFGA 136
            ::::.:..:..|..|                     |.:||.|:.::|....||:    .|....
  Fly   106 AQRQDEFRWRQSPME---------------------LSSANRIFVDRTINVSNKF----NTLLYG 145

Human   137 EPQPVNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQN 201
            ..:.::|....:...|:||.|:..:|..:|:::|..:.:...|.::|.||.|.||.|..||.|:.
  Fly   146 ATKELDFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEE 210

Human   202 TTEKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQL-------YYKSR-----------DL 248
            |..|||.|||   :..:|::|..|...|.:...:.:..|:       .|||:           |:
  Fly   211 TALKPFFINE---REQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDI 272

Human   249 SLLILLPEDIN-GLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSYDLKSTLSSMGMS 312
            |::|:||.... .|.::...:..:.:.:|....:.:  :::|.||||:.|...:|...||.||::
  Fly   273 SMIIILPNSNKISLNRVISRLNADSVKKWFERALPQ--KIELSLPKFQFEQRLELTPILSLMGVN 335

Human   313 DAFSQSKADFSGMSS-ARNLFLSNVFHKAFVEINEQGTEAAAGSGSEIDIRIRVPS-IEFNANHP 375
            ..|::: |.|..::: ..:|.:.:..|.|.::::|.|:.|||.:...:....|.|. .:||.|||
  Fly   336 TMFTRN-ATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHP 399

Human   376 FLFFIRHNKTNTILFYGRLCSP 397
            |:|.|...|.:||||.|....|
  Fly   400 FVFLIYDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB10NP_005015.1 PAI-2 4..397 CDD:239013 107/410 (26%)
Nuclear localization signal 74..77 0/2 (0%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 107/407 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.