DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB9 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:368 Identity:128/368 - (34%)
Similarity:205/368 - (55%) Gaps:22/368 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    15 LLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTE--EDIHRAFQSLLTEV 77
            :.::|.:.:.:.|:..|||||.:.|:||.:||:|:||.::..||.|.:|  |.:...:.:||.::
  Fly    21 IYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDKEAVAARYGALLNDL 85

Human    78 NKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIR---AAEESRKHINTWVSKK 139
            .......:|:.|||::..........:..:..:.:.:|.:.:|...   |||    .||.||..:
  Fly    86 QGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAE----RINQWVLDQ 146

Human   140 TEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATF 204
            |.|||:.::...|:.::.:.:|||||||||:|...||...||...|::...:..|||||.|..||
  Fly   147 TSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTF 211

Human   205 KLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLL 269
            :..:..::.||::||||....||:.:.||.:...||.:|     ||:..:.:|  :.:.||.:.|
  Fly   212 RANYFRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALE-----EKIVGFARP--LVAKEVYLKL 269

Human   270 PKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERD-LCLSKFVHKSFVEVNEEGTEAAAAS 333
            ||||::...:::..|..|||.:.|.. |:|||.:.|::. ..:|:..||:|:||||||.|||.|:
  Fly   270 PKFKIEFRDELKETLEKLGIRELFTD-KSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGAT 333

Human   334 SCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP 376
            |..|.......:  ...|||||.|.||.  ||:|.|.||..||
  Fly   334 SVAVTNRAGFST--FLMADHPFAFVIRD--ANTIYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 126/366 (34%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 125/363 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.