DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINB8 and nec

DIOPT Version :9

Sequence 1:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:387 Identity:109/387 - (28%)
Similarity:186/387 - (48%) Gaps:48/387 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    11 FAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDG-DIHRGFQSLL 74
            |:..|||.:.:..:.:||.|||.|:.:.||:::..:.|.|..::.:|....|:. .:.:.|:|::
  Fly   110 FSSELFKEIIKSQSQQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFESVI 174

Human    75 S-EVNRTGTQYLLRTA---NRLFGEKTCDFLPDFKEYCQKFYQA--ELEELSFAEDTEECRKHIN 133
            . :.:..|....|.|.   ||..|...    ..:.||.:.::.|  |..::..|:||   ...||
  Fly   175 KYKKHLEGADLTLATKVYYNRELGGVN----HSYDEYAKFYFSAGTEAVDMQNAKDT---AAKIN 232

Human   134 DWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQF--------DRKYTRGMLFKTNEE 190
            .||.:.|..||.:::....|||.|:.:||||:||:|:|..:|        |.::|.|.:.|    
  Fly   233 AWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYFQGRWEHEFATMDTSPYDFQHTNGRISK---- 293

Human   191 KKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVVEKALTYEKFKAWTN 255
               |.|||.:..:.:....|:....|||.|.:...||:||||::.|.|..:.:.|:..:|.....
  Fly   294 ---VAMMFNDDVYGLAELPELGATALELAYKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRV 355

Human   256 SEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSGMSTEKNVPLSKVAHKCFVE 320
            :.:|.:..|.|.||:.:.|...|:...|:.||:...|.........|  ::.|.:||:..|.::.
  Fly   356 AHRLRRQSVAVRLPKFQFEFEQDMTEPLKNLGVHQMFTPNSQVTKLM--DQPVRVSKILQKAYIN 418

Human   321 VNEEGTEAAAATAVVRNSRCSRMEP--------RFCADHPFLFFIRHHKTNCILFCGRFSSP 374
            |.|.||||:||:       .::..|        .|.|:.||:|.:|...:  :||.|....|
  Fly   419 VGEAGTEASAAS-------YAKFVPLSLPPKPTEFVANRPFVFAVRTPAS--VLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 108/385 (28%)
necNP_524851.1 SERPIN 108..468 CDD:238101 108/382 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.